KEGG   Citrus sinensis (Valencia orange): 102613074Help
Entry
102613074         CDS       T02983                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00010  Glycolysis / Gluconeogenesis
cit00053  Ascorbate and aldarate metabolism
cit00071  Fatty acid degradation
cit00280  Valine, leucine and isoleucine degradation
cit00310  Lysine degradation
cit00330  Arginine and proline metabolism
cit00340  Histidine metabolism
cit00380  Tryptophan metabolism
cit00410  beta-Alanine metabolism
cit00561  Glycerolipid metabolism
cit00620  Pyruvate metabolism
cit00903  Limonene and pinene degradation
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102613074
   00053 Ascorbate and aldarate metabolism
    102613074
   00620 Pyruvate metabolism
    102613074
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102613074
   00561 Glycerolipid metabolism
    102613074
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102613074
   00310 Lysine degradation
    102613074
   00330 Arginine and proline metabolism
    102613074
   00340 Histidine metabolism
    102613074
   00380 Tryptophan metabolism
    102613074
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102613074
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    102613074
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102613074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 102613074
NCBI-ProteinID: XP_006476755
LinkDB All DBs
Position
5
AA seq 538 aa AA seqDB search
MAAARRISTLLSRSFPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKN
LINGQFVDAASGKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYE
RSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLT
VPGDGNYHIQTLHEPIGVAGQIVPWNFPVLLFTWKVAPALACGNTIVLKSAEQTPLTALY
LAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLSFTGHCDTGKIVQELAAKSNLK
PVTLELGGKSPFIIFDDADVDQAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFVEKAK
ARAMRRIVGDPFKNGVEQGPQIDPEQFQKVLRYIRSGIESNATLECGGDRLGNRGYFVQP
TVFSDVTDDMLIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADTANTMM
RALRAGTVWINCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNPAWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgctcgcagaatctccaccttgctgtctcgttctttcccttctgcttctcct
tctctgcttcgctctcttggtagggagtctagcagggcaagaggcatcagcaggtttagc
acagctgctgttgttgaagagccaatcattccacctgttcaaattagttacactaagaat
ttaataaatggccaatttgtagacgcagcatcaggcaaaacatttccggtctacgaccct
cgtactgctgaagtgattgctaatgttgctgaaggagatgcggaagatattgaccgtgca
gttgctactgctcgcaaggcatttgatgagggaccttggccaaagatgaccccttatgag
aggtcaaggattatgttgcgggctgctgatttgattgagaaaaacatggaggagctggca
gctttggagacatggaacaatggaaagccctatgtacaatctctcaaatctgaagtacca
atggtggttcgcctgttgcactattatgctggctgggctgataaaatccatggactaact
gtccctggtgatggaaattaccatattcaaactttacatgaaccaattggcgttgctggc
cagatagttccctggaactttcctgttctcttgtttacttggaaagtagcgcctgcacta
gcttgtggtaatactattgttctaaagtctgctgagcaaacgcctttgactgctctgtat
ttggcaaagctattccatgaggctggtcttccccccggtgttttgaatgtagtctctggt
tatggtccaacagctggtgcagctcttgccagccatatggatgtggacaagctgtctttt
acaggacactgtgatactggtaagattgttcaggaattggctgcaaaaagcaaccttaag
ccagtaaccttagaacttggagggaaatcaccatttataatattcgatgatgctgatgtt
gaccaggctgtggaacttgcacactttgctttgttctataatcagggacaatgttgctgt
gctggatctcgtacttatgtacatgagcgtgtatatgacgagtttgtagaaaaagcaaag
gcacgtgctatgaggcgtattgttggcgatcccttcaagaatggtgttgaacaaggtcct
cagattgatccagagcaatttcagaaggtccttaggtacataaggtctggaattgaaagc
aatgcaacccttgagtgcggaggtgatagattgggcaacagaggctactttgttcagcca
actgtcttctcagatgttacggatgacatgttgatagcacaggatgaaatctttggcccg
gtgcaatccatcttgaagttcaaggaaactgatgacgttataagaagagcaaataaaaca
cgctttggtctagctgctggggttttcaccaagagtgcagacactgcaaacaccatgatg
cgtgcactgagagctgggactgtatggattaactgctacgacgtgtttgatgctgctatt
cctttcggtgggtacaagctgagtggcataggccgggaaaagggaatttacagccttaac
gcttacttgcaagtaaaggccgtcgttcaacctgtgaagaacccagcatggctttag

DBGET integrated database retrieval system