KEGG   Citrus sinensis (Valencia orange): 102614598Help
Entry
102614598         CDS       T02983                                 

Definition
(RefSeq) thymidine kinase a
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00240  Pyrimidine metabolism
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102614598
Enzymes [BR:cit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     102614598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 AAA_22
Motif
Other DBs
NCBI-GeneID: 102614598
NCBI-ProteinID: XP_006469524
UniProt: A0A067ETL2
LinkDB All DBs
Position
2
AA seq 240 aa AA seqDB search
MAASNLKPAAVTTNQVNSGRDRVGLPHRNSGEIHVIMGPMFAGKTTALLRRIRSESDNGR
NIAMIKSSKDTRYAIDSVVTHDGAKLPCWALPELTSFRQKLGDDAYAKLDVIGIDEAQFF
EDLYEFCCNAADHDGKTVVVAGLDGDYLRRSFGSVLDIIPLADTVTKLTARCELCGKRAF
FTLRKTEETETEIIGGADVYMPVCRQHYVNGQVVIGAARNVLEFHKVQSKSCVEAAAAAI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccaacctcaagcccgcagcagttaccacgaatcaggtcaatagtggccgc
gaccgtgtgggactgccccaccgtaattccggggagatccacgtcatcatgggtcccatg
tttgccggaaaaaccacggcgctcctccgtcgtatcagatccgaaagcgacaatggcaga
aatattgcgatgataaaatcgagcaaggacacgagatacgcgattgactcggtggtgact
catgatggggctaagcttccgtgttgggctctaccggaactgacgtcgttccgacagaaa
ctcggagatgatgcttacgcgaagcttgatgtgattggcattgacgaagctcaatttttc
gaagacctatatgaattctgctgtaatgccgcagatcatgatgggaaaactgtagtagtt
gctggccttgatggtgattatttgagaaggagctttggttcagttcttgatataataccc
cttgctgataccgtaaccaagttgaccgctcgctgtgaactctgcggcaaacgggcattc
tttactttgcgaaagacagaggaaacagagactgaaattattggtggagctgatgtctac
atgcctgtttgccgccagcactacgtcaatggccaagtggtcattggagctgctaggaat
gtcctggaatttcataaggttcagagcaaatcctgtgttgaggcagcagctgcagctatc
taa

DBGET integrated database retrieval system