KEGG   Citrus sinensis (Valencia orange): 102618631Help
Entry
102618631         CDS       T02983                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit03030  DNA replication
cit03410  Base excision repair
cit03420  Nucleotide excision repair
cit03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102618631
   03410 Base excision repair
    102618631
   03420 Nucleotide excision repair
    102618631
   03430 Mismatch repair
    102618631
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cit03032]
    102618631
   03400 DNA repair and recombination proteins [BR:cit03400]
    102618631
Enzymes [BR:cit01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102618631
    6.5.1.6  DNA ligase (ATP or NAD+)
     102618631
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102618631
DNA replication proteins [BR:cit03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102618631
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102618631
DNA repair and recombination proteins [BR:cit03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102618631
   NER (nucleotide excision repair)
    Other NER factors
     102618631
   MMR (mismatch excision repair)
    Other MMR factors
     102618631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL Lactamase_B_2 Peptidase_M57
Motif
Other DBs
NCBI-GeneID: 102618631
NCBI-ProteinID: XP_006482181
LinkDB All DBs
Position
6
AA seq 1402 aa AA seqDB search
MDSHPSDKNLTLDSTHLFLSTQSSPPDSLIFAPIPRTLPPSKHIPSTRFLIDAFRYAADF
SVSYFLSHFHSDHYTGLSPSWSKGIIFCSEITSRLLSQILNINPKFIYPLPIKIPVLIDG
CEVVLVGANHCPGAVQFLFKVPGRNGGFERYVHTGDFRFCKTMLLQPVMNEFAGCDAVFL
DTTYCNPKFLFPLQEESVEYVVNVVNRVGGELNEGLQKRVLFLVATYVIGKEKILIEIFK
KCGRKVCVDSRKMEVLRVLGYGDSGVFTEDESETDVHVVGWNVLGETWPYFRPNFVRMKE
IMVERGYDKVVGFVPTGWTYEVKRNKFAVRSKDAFEIHLVPYSEHSNYDELREYVKFLKP
KQVIPTVGMDIEKLDSKHANKMRKYFAGLVDEMASKKEFLMGFHRGTSEIDENVEEGAGS
GSNEGLSKEGEVKLKKTKATEDNSSSILLDSSSRLEEFGSKDVTALDDEETEKMVQEIRN
CLPTWVTQNQILDLISSSGRNIVDAVSNFYEHETQLYEQVSACTTFISTSQTSSLDVSAS
TAKLNSDKTISQGSVKIPLSQEYKLPTIKHSIKSTLSPSKRKKTITNNPKKKGKVPSKME
SSGAKQPTITSFFNKLLPNMSQGDVVESKSEECPKDENPLQSNAIKTYGEEIDQFLKIIN
GNESLKGYAATLLEKTKGNVSMALDLYYDNQEGDHGKTVNRLEFSKSSVQFDNCNKDCSS
ALEKIVSEELQHITDMSVQRPSKELMDPTLVSLPPEKYDPIEHACWSSGQPAPYIHLART
FDLVEAERGKIKAMSMLGNMFRSLLALSPDDVLPAVYLCTNKIASNHENIELNIGGSLVT
SAIEEACGTNRSKIRDMYNRLGDLGDVAQECRQTQALLAPPPPLLIKDVYSMLCKISVQI
GSGSTARKKSLIVNLMCSCREKEMKFLVRTLVRNLRIGAMMRTILPALAQAVVMNSSLEF
SHEGKMENLKEKLQSLSAAAVEAYNILPSLDLLIPSLMNKGIGFSSSTLSMVPGVPIKPM
LAKITNGVPQVLKLFQNKAFTCEYKYDGQRAQIHKLVDGTVRIFSRNGDETTSRFPDLIS
IINEFCKPAAGTFILDAEVVAIDRKNGCKIMSFQELSSRERGGKDSVITIKSVKVDICVF
VFDIMFANGEQLLGYTLRQRRKYLKDLFYDEKMGYFQYAKEMTVEGDDNCLTSDVSLSKI
NNFLEEALHSSCEGIIVKSLDVDAGYSPSKRSDSWLKVKRDYVEGLNDSLDLVPIGAWHG
NGRKAGWYSPFLMACYNPETEEYQSVCRVMSGFSDSFYIEMKEFFSGDKILLKKPSYYRT
AEVPDMWFSPEVVWEIRGADFTISPVHQAAIGLVHPSRGISIRFPRFIRLVSDRNPDECS
TAADIAEMFHSQTRKMDVTAKD
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atggactctcatcccagtgacaaaaacttaaccctagactcaacccacctcttcctctcc
acccaatcttcccctcccgattccctcattttcgctccaattccccgcactttacctcct
tccaaacacattcccagcacccgcttcctcatcgacgcctttcgctacgccgccgatttc
tccgtctcttactttctctcccacttccactccgatcactacaccggcctttccccttct
tggtccaaaggtatcattttttgctccgaaatcacttcccgccttctttctcagatactc
aacataaaccccaagtttatctacccactcccaattaagatacctgttttaattgatggg
tgtgaagttgttcttgttggtgccaatcattgccctggtgctgtccagttcttgttcaag
gttccgggcagaaatggcggtttcgagaggtatgttcacacgggtgattttcggttttgt
aaaactatgttgttacagcctgtgatgaatgagttcgcgggttgtgatgctgtcttttta
gacaccacttattgtaatccgaagtttttgtttcctttgcaagaagagagtgttgagtat
gtggttaatgtggttaatagggttggaggcgagcttaatgagggtttgcagaagagggtt
ctgtttcttgttgcgacatacgttattgggaaagaaaagattttgatcgaaatttttaag
aaatgtggtagaaaagtgtgtgtggattcaagaaaaatggaggttttgcgggttttgggg
tatggggatagtggtgtttttacagaggatgagagtgagactgatgtgcatgttgttgga
tggaatgtgttgggggagacttggccatactttcggccgaattttgtgagaatgaaggaa
attatggtcgaaagaggatatgataaggttgttggttttgtgccgacggggtggacttat
gaggtgaagcgtaacaagttcgcagtgaggtccaaggacgcatttgaaattcatcttgtc
ccatatagtgagcattcaaattatgatgagcttagggagtatgtgaagtttttgaaaccc
aagcaagttatacctacggtgggcatggatattgagaagcttgatagcaagcatgctaat
aaaatgagaaagtattttgctgggttggttgatgaaatggctagcaagaaagaattttta
atgggttttcatcgagggactagcgaaattgatgaaaacgttgaagagggtgctggttca
ggctctaatgaggggctgagcaaagagggggaagtaaagttgaaaaaaactaaagccact
gaagacaacagttcatctattcttttagattcatcatctcgtttggaagaatttggctca
aaagatgtaactgctctagatgatgaggaaacagagaaaatggtacaagaaattcgtaac
tgtttgcctacatgggttactcaaaaccaaatattggatttgattagcagctcaggaagg
aacattgttgacgctgtgtctaatttctatgaacatgaaactcaattgtatgagcaagtc
tctgcatgtacgacttttatatctacatcccagaccagctcacttgatgtttctgcatcc
actgcaaaactaaattccgataagaccatttcccaaggaagtgtgaaaattcctttaagt
caggaatacaagttaccaaccataaagcattcaataaagagcaccctttctccaagcaaa
aggaagaaaactattaccaataaccctaagaaaaaagggaaagtcccatcaaaaatggaa
tctagtggggcaaagcagcctacaattacaagtttcttcaataaattgttgcctaacatg
tctcaaggggatgtggttgaatccaagtcagaggaatgccctaaagatgaaaatcctttg
caaagtaatgctatcaaaacatatggagaggagatagatcagttcttgaagataatcaat
ggcaatgaatcattaaaaggctatgctgccaccctcttagagaagacaaaaggaaatgtt
agtatggctctagatctatattatgataatcaagagggtgatcatggtaagactgtaaat
aggttagaattctctaaaagttcagttcagttcgacaattgtaataaggattgttcttct
gcattggagaaaatcgtttctgaagaattgcaacatataactgatatgtctgttcagaga
ccatcaaaagaactaatggatccaactcttgtgtcattaccacctgaaaagtacgatcca
atagagcatgcatgctggagtagtggacagcctgctccatatatccaccttgcacgaact
tttgacctggttgaggctgaaagaggcaagataaaagctatgtccatgttgggcaatatg
tttagaagtttgctggccctgtctcccgacgatgtgctacctgctgtgtatttgtgtacc
aataagattgcctctaaccatgaaaacatagaactgaacattggtggaagtttggtcaca
tcagcaatagaagaggcatgtggaactaatcggtctaaaattagggatatgtacaatagg
ttaggtgaccttggtgacgttgctcaagaatgccgacaaacacaggcattgcttgctcct
cctcctccacttcttatcaaagatgtatattctatgctttgcaaaataagtgtacaaata
ggtagtggaagtactgctaggaagaaaagccttattgtgaacctcatgtgttcttgtaga
gagaaggagatgaagtttctggttagaactctggtcaggaatttacgaattggagcaatg
atgagaactatattgcctgcattagctcaagctgttgttatgaattcttctcttgagttt
tcccatgaaggaaaaatggaaaatttgaaggagaaacttcagagtctttctgcagcggca
gttgaagcttataatattcttcccagtttggatttgctcatcccttctctcatgaataaa
ggcattggattttcatcatcaactttgtccatggttccaggagtacctatcaagcccatg
cttgcaaaaattaccaatggagttccacaagtactaaagctcttccaaaataaagcattt
acttgtgaatacaaatatgatggtcaacgtgcccaaattcacaaattagtggatggcact
gtgcgcatcttttcacgtaatggggatgaaacaacatcaagatttcctgatttaattagt
ataattaatgaattttgtaagcctgctgcggggactttcatactggatgccgaggtagtt
gcaattgataggaagaatggctgcaaaatcatgtctttccaagaactatcgtcaagagag
agaggaggaaaagattccgtgatcacaattaagagtgtaaaggtcgatatttgtgtattt
gtctttgatatcatgtttgccaatggagagcagctgttgggttataccctccgtcagaga
cgaaaatacttgaaagatttgttctatgatgagaaaatggggtactttcagtatgcaaag
gaaatgactgtggaaggtgatgataattgtttgacgagtgatgtctctctaagcaagata
aataattttcttgaagaggcactccactcctcatgtgaagggattatcgttaaatcgtta
gatgttgatgctggatattctccatcaaagcgtagtgactcatggttaaaggtgaagcga
gattatgtggaaggattaaatgactcgcttgatctagtccctattggtgcttggcatggc
aatgggaggaaagctggatggtacagtccattcctcatggcatgttacaatcccgagact
gaggaatatcaaagcgtatgccgtgtcatgtctgggttctcagattccttttacatagag
atgaaggaattcttttctggggataagatcttattgaaaaagccgtcttactatcgaaca
gctgaggttccagatatgtggttttctccagaagttgtttgggaaataagaggtgcagac
tttacaatatcaccggttcaccaggctgctataggtttggttcatccgagccgtggcatc
tcaatcagatttcctaggtttatacgccttgtatctgacagaaatccagatgaatgtagc
actgctgcagatatagctgaaatgtttcactctcaaacccggaagatggacgtgacagcc
aaagattga

DBGET integrated database retrieval system