KEGG   Citrus sinensis (Valencia orange): 102618782Help
Entry
102618782         CDS       T02983                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102618782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cit03036]
    102618782
Enzymes [BR:cit01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102618782
Chromosome and associated proteins [BR:cit03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102618782
   Polycomb group proteins
    PRC2-EZH2 complex
     102618782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 102618782
NCBI-ProteinID: XP_006494449
LinkDB All DBs
Position
Unknown
AA seq 925 aa AA seqDB search
MASKASPSASPNRSEPLKSSSLTKTENGTLTRKEILSVIDCLKNQVAADHFVSVQRRVEK
NRQKLIGVTNHLYRLSLERRNNQTINTHGSVDLLTKRQREALGVQNGIDVSSGDRDSHIS
QEDGYASTAVYGSSNPTKNVIRPIKLNDNKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIY
YDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYILRMTIKEVGLSDATLESLAQCFSRSP
SEVKARYEILSKEESAVGGSNNGNDEHTMNNFLVKDLEAALDSFDNLFCRRCLVFDCRLH
GCSQDLVFPAEKQPLWYHLDEGNVPCGPHCYRSVLKSERNATACSPLNGDIKEKFVSSSD
GAGAQTSSRKKFSGPARRVKSHQSESASSNAKNLSESSDSEVGPRQDTTFTHHSSPSKSK
LVGKVGICKRKSKRVAERALVCKQKKQKKMAAFDLDSVASGGVLPSDMKLRSTSRKENED
ANSSSHKHAKSSSSGKTRKKEMQIQDSRNLMHVRVPLGSSQEIVSNPPAISTNDSLRKDE
FVAENMCKQELSDEKSWKTIEKGLFDKGVEIFGRNSCLIARNLLNGLKTCWEVFQYMTCS
ENKLFCQAGDAATSLLEGYSKFDFNGTTGNNEVRRRSRYLRRRGRVRRLKYTWKSAAYHS
IRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS
QCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLL
GRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLD
AYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAW
ARKPEASGSKKEEGGPSSGRAKKLA
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaaggcatcgccttctgcctctcctaacagatcggagcctctcaaaagctct
tcgttgacaaaaacagaaaatggaactctgactcgtaaggagattttatctgttattgat
tgtttaaagaatcaggttgctgctgaccattttgtttccgttcagagaagggtggaaaaa
aataggcaaaagttgattggtgttacaaatcatctgtatagactatcattggagagaaga
aacaaccaaacaataaatacacatggtagtgtagatttactaacaaagaggcaaagagaa
gcgcttggtgtgcaaaatggtattgatgtaagtagtggggatagagatagtcacatatct
caggaagatggttatgcttctaccgcagtttatggatctagtaaccctaccaagaatgtt
attcgtcctattaagctcaatgacaataaaagattacctccttataccacatggatattt
ttagacagaaatcaaagaatgactgaggatcaatcggtgatgagtcgaaggagaatttat
tatgaccaaaatggtggtgaagcactaatctgcagtgacagcgaggaggaagtaattgag
gaagaggaaaagaaagattttgtggattctgaagattatattctgcgcatgactattaaa
gaagttggtttatctgatgccacgctggaatcactggcccaatgtttctccagaagccct
tctgaagtcaaggcaagatatgaaattttgtcaaaggaagagagtgctgtagggggctct
aacaatgggaatgatgagcacactatgaataactttcttgtaaaagatcttgaagcagct
ctggattcttttgacaacctgttttgtcgccgatgtcttgtctttgattgcaggttacat
ggatgttcacaggatcttgtctttccggctgagaaacaacctctgtggtaccatctagac
gagggaaatgtaccatgtggaccacattgttatcgatcggttctcaagtcagaaagaaat
gctacagcgtgctcacccttgaatggtgatatcaaagaaaaattcgtctcttcatctgat
ggtgctggggctcagacatcatctaggaagaaattttctggtcctgctagaagggtgaag
tcccaccaaagtgaaagtgcttcttcaaatgcaaaaaacctttcagaaagcagtgattca
gaggttgggccgaggcaggacaccacttttactcaccactcatcaccctcaaagagtaag
cttgtagggaaagttggaatctgcaagaggaagagcaagcgagttgctgagcgcgctcta
gtttgcaagcaaaagaaacagaagaaaatggcagcttttgatttggattctgttgcgagt
ggaggtgttttgcccagcgacatgaaacttaggtcaacttctcgcaaagaaaatgaagat
gctaattcctcttcacataagcatgcaaaatcttcatcctctgggaagaccaggaagaag
gaaatgcaaattcaggacagccgcaatttgatgcatgtcagagttccccttggctcgtca
caggagatcgtttctaatccacctgcaatcagcactaatgactccttgagaaaagacgag
tttgtggctgaaaacatgtgtaaacaagaactaagtgatgagaaatcttggaaaactatt
gaaaaaggcctctttgataaaggtgttgaaatttttggcaggaacagctgtctgatagcc
agaaacctattaaatggtttgaagacttgttgggaggttttccagtatatgacttgctct
gagaataaactattttgccaagcaggtgatgctgcaacttctcttcttgaaggctattca
aagtttgattttaatggaactacgggtaacaatgaagtgagaagaagatcaagatattta
cgtaggaggggtagagttcgtcgcttgaagtatacttggaagtctgctgcttaccattca
attaggaaacggatcactgagagaaaagatcagccatgccggcagtacaatccttgtggc
tgccaaactgcttgtggaaagcaatgtccttgccttctaaatggaacctgctgtgaaaag
tactgtggatgtcccaagagctgcaaaaatcggttcagaggctgtcattgcgctaaaagt
caatgtcgcagtcgtcagtgtccatgttttgctgctgaccgggaatgtgatccagatgtt
tgtaggaactgttggatcagttgtggtgatggtagtcttggggttcctgaccaaaaaggt
gataactatgaatgtaggaatatgaagcttctgctcaaacaacaacaaagggttttactt
ggaagatccgatgtttctgggtggggagctttcttaaagaatagtgttggaaagcatgaa
taccttggtgaatacactggcgagctgatttctcatcgggaggctgacaagcgtgggaaa
atatatgatcgtgaaaattcatcatttctgttcaatctgaatgatcagtttgttcttgat
gcttatcggaagggtgataaactgaaatttgccaatcattctcctgatccaaactgctat
gcaaaggtcatcatggttgcgggagaccaccgtgttggcatctttgccaaggagcgaatt
agtgccggtgaggaactgttttatgactatcgttatgagccagacagagctcctgcttgg
gctaggaagcctgaagcatctggttcaaaaaaggaggaaggtggtccttcaagtggtcgt
gccaagaagcttgcttag

DBGET integrated database retrieval system