KEGG   Citrus sinensis (Valencia orange): 102621779Help
Entry
102621779         CDS       T02983                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102621779
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cit02000]
    102621779
Enzymes [BR:cit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102621779
Transporters [BR:cit02000]
 Other Transporters
  Pores ion channels [TC:1]
   102621779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_N_4 GST_C_5 GST_C_3 Tom37
Motif
Other DBs
NCBI-GeneID: 102621779
NCBI-ProteinID: XP_006477979
LinkDB All DBs
Position
5
AA seq 219 aa AA seqDB search
MADEVILLDFWASMFGIRVRIALAEKGIKYEYKEQDLFNKSPLLLQMNPVHKKIPVLIHN
GKSVCESSIIVQYIDEVWKDKAPLLPYDPYQRAQARFWADFIDKKMYDTSRKTWATKGEE
QEAAKKEFIEVLKTLGGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEAECP
KFIAWVTRCLQRETVAKALPDEKKVFEFVSVLREKIRVE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagtgattctattggatttctgggccagtatgtttgggataagggtcagg
attgctctggcagagaaaggcatcaagtatgagtacaaagaacaggacttgttcaacaag
agcccgctgcttctgcagatgaatcccgtccataagaagatcccggttcttatccataat
ggcaaatcagtctgtgagtcatccatcattgttcagtacattgatgaagtctggaaggac
aaggctccattgcttccctacgatccttaccaaagagctcaagcgaggttctgggccgat
tttattgacaagaagatgtacgatacttcgaggaagacatgggccacaaagggagaagag
caggaggcagcaaagaaggagttcatcgaagttctgaagaccttgggaggggagcttgga
gacaagccttttttcggaggagacaactttgggtatgtggatttgtgtttgatcccgtac
tattgttggttttattcgtatgagacatttggaaagttcagcgttgaggctgagtgcccc
aaattcattgcttgggtgacgagatgcttgcagagagagactgttgccaaggcacttcct
gatgagaaaaaagtgtttgaatttgtttcagtgttgagggaaaaaattagagttgagtaa

DBGET integrated database retrieval system