KEGG   Citrus sinensis (Valencia orange): 102623523Help
Entry
102623523         CDS       T02983                                 

Definition
(RefSeq) uncharacterized protein LOC102623523
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00061  Fatty acid biosynthesis
cit00780  Biotin metabolism
cit01100  Metabolic pathways
cit01212  Fatty acid metabolism
Module
cit_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102623523
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    102623523
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cit01004]
    102623523
Enzymes [BR:cit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     102623523
Lipid biosynthesis proteins [BR:cit01004]
 Fatty acid synthase
  Component type
   102623523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 102623523
NCBI-ProteinID: XP_006492623
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MATTPAASFANSLLSLNSHRPNPNASSIPKPNTLSIQFDKKKNQQQQQHQRHARFTTFCS
LDAEPKDPIEDKPIELRYQAFPTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKN
VTINDNFFPGHFPDRPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGIDKVRFRKP
VIAGDTLVMRMTLVKLQKRFGIAKMEGKAYVGGEVVCEGEFLMATGS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggccactacccctgctgcttcttttgccaattcacttttatctctcaattctcatcga
ccaaacccaaatgcctcctctattccaaaacccaacactctctccatccaatttgacaag
aagaagaatcaacaacaacagcagcaccaacgacatgctcgtttcaccacattttgttct
ttggacgctgaacccaaagatcccatcgaagataaacccatcgaacttcggtaccaggca
tttcctacagtgatggacattaaccagattcgtgacattttgccacacaggttcccattt
cttttggtggatagagttattgaatacaatccaggagtttcagctgttgctattaagaat
gttactattaatgataacttctttcctggccattttcctgataggccaattatgcccggt
gttctcatggttgaggcaatggcacaggttggtggcttggttatgctgcaaccagaagtg
ggaggctctcgtgaaaatttcttctttgctggaattgataaagtaagattcaggaaacca
gtgattgcaggtgacactttggtcatgagaatgacacttgtcaagctacagaaacgcttc
ggaatagcaaagatggaagggaaagcttatgtgggaggtgaagtggtctgcgagggtgag
tttttgatggctaccggtagttaa

DBGET integrated database retrieval system