KEGG   Citrus sinensis (Valencia orange): 102623970Help
Entry
102623970         CDS       T02983                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00020  Citrate cycle (TCA cycle)
cit00190  Oxidative phosphorylation
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
cit01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102623970
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102623970
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102623970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102623970
NCBI-ProteinID: XP_006466784
LinkDB All DBs
Position
1
AA seq 632 aa AA seqDB search
MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGGYTIVDHTYDAVVVGAGGAGL
RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
DQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAAD
RTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTI
LATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLITEGSRG
EGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPP
DVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVV
PGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERT
VAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLT
DRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGY
WENEKVRLDYRPVHMNTLDDEIESFPPKARVY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtggccttggcttatcttcttatcgttcaaaacgatcagtc
tccaatgactctctcagatctcatttctccagattgttctccaccaattccactggagga
tacacaatagtggatcatacatatgacgctgtagtggttggagctggcggtgctgggctg
agagcagcgattgggctttcagagcatggcttcaacaccgcttgcattaccaagctcttc
cctactcgttctcacactgttgcggctcagggtggtattaatgctgctttaggaaacatg
actgaagatgactggaggtggcacatgtatgacacagtcaagggaagtgattggttaggt
gatcaggatgctattcaatatatgtgtagggaggcaccaaaagcagtgattgagctggag
aattacgggttaccattttctcggacagaagatggaaaaatataccagcgtgcatttggc
ggtcaaagtcttgattttggaaaaggtgggcaggcgtaccgttgtgcatgtgctgctgac
agaactggtcatgctctattgcataccctctatggccaggctatgaaacataatacacag
ttctttgtggaatattttgctttggatctaattatgaacagtgatggtacctgccaagga
gtaattgctttgaatatggaggacggaacattgcatcgtttccgtgctgcttcaaccatt
ctggccacagggggctatggtagggcctacttttctgcaacctctgctcatacatgcaca
ggagatggcaatgcaatggtttcgcgtgctgggctcccacttgaggatttggaatttgta
caatttcacccaactggtatatatggggctgggtgccttattactgaaggatctcgcggt
gaaggtggtatccttagaaatagtgaaggtgaacgatttatggaacgttatgcccctaca
gccaaggatcttgcatcaagagatgttgtttcaagatccatgaccatggaaattcgggaa
ggtcgtggtgtaggacctctgaaggaccatatctatctacacttgaaccacttgcctcca
gatgtactcaaggagaggcttcctggtatatctgaaactgctgctattttcgctggtgtt
gatgtcacgaaggagcctattcctgtcttaccaactgtgcactataatatgggtggaatt
ccaactaatcaccatggagaggtagttactatcaaaggtgatgatccggatgaagtagtt
cctggacttatggctgctggggaggctgcctgtgcatcagttcatggtgccaaccggctg
ggtgcaaattctcttcttgacattgttgttttcggtcgagcttgtgcaaatagagttgca
gaaatccagaggccaggggagaaacaaaagcctttagaaaacaatgctggtgagaggacc
gttgcctggctggacaaaataagaaattcaaatggttcaataccaacttcaaaaattcgg
ttgaatatgcaacgcgtgatgcaaaataatgccgctgtcttccgaacacaggaaacattg
gaggaaggttgtcaattaattgacaaggcatgggagagtttccatgatgttaagttgaca
gatcgtagtttgatatggaacactgacttgatagaaactatagagttggaaaaccttttg
ataaatgcatgcatcaccatgcattctgctgaagccaggaaagagagtagaggagctcat
gcacgtgaagattttacgaaaagagatgatgagaactggatgaagcacactctgggatat
tgggagaatgagaaggtacgattggattacagaccagttcacatgaatacgctggacgat
gaaattgagtccttcccacctaaagctcgtgtatattga

DBGET integrated database retrieval system