KEGG   Citrus sinensis (Valencia orange): 102624482Help
Entry
102624482         CDS       T02983                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2 isoform X2
Organism
cit  Citrus sinensis (Valencia orange)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 102624482
NCBI-ProteinID: XP_015384149
LinkDB All DBs
Position
3
AA seq 2478 aa AA seqDB search
MGSCENLTSVDEPSCNSVFEQHSSLKFMEEPVSEQRMCLKTRFDVLDANVSGSTKLDGRL
GLSIDDTTHCVSCGDAGDTGIGNKDGLIDEFQNVVGVSLEKAIDDECGVSRVCFIESQEE
IGVCSSPGRCLDLSQDGNNSYVSSAYVTEAVVGDRDGSVSKCDNVSGSGLEKLVDESQSK
VDSEAVVGDRDGPASECNNVSGLVLEKLVDEEQGVCLDGSQSEVDVCGNGLCVEKGGFQG
EDLESFKHQKLPLGEVPSNCSPRNCDRRDKQKDDQGFNRSSVEETVEVTGVETNALAEVK
LGNDNQTLSSDAYEMPLKSIPVGGLTRNCVQQHGQKGDNILSCLPGEEGVMIKKSDELAE
LEKVPCDLIMPFGSFGIPLTGSPRNFVQHGDQKDGRTVSCSSSEGDMEGKEVKTDALDEI
EKVNCFQISPSQFCEMPPELLPFTGSPNNSVQQEDQKNDNTAGCTSSEGDMECIEEKTDA
LSGKMKVTCDQMLPSQCCEMDSEAISLVDSPTDCVQLGNQENNKNGGSLSSKSAKEVIED
KMGTCGQILPSQGCSMTPELIPKTDSLRNCTQQNEQKSNECICVPSLEEEGKNYASLGIE
IDICGHMLSFQECEIRSESTLVTEKQLIVEAKRDIVHGLENDSGHPRSPLEHTEPRMEFA
SATDLSFRCIQKKEQQGIESLAEGKANLSAAVEANMWKANLAAAVEANMCNCISASQDGE
TPFKVFYEDDLMRTCEGHKDHVDHESIGHLAVGTVEQKDNTDTCILALPMQSCQSSLESL
RIADSLSNCSQQNDQGNNKSVDGLSAESATEAVEEKSDVTTDIKVEICSQLSPIEENEKE
HSSRVIEKPISLQSCQPFAVDENGSCKSLNVAGLSQKDGFGAISSSGAVDGFGQINHEVK
DDVGTNCFSETKYPNRVSLSSRRSSRISRSSQKTQTKRAARNCRTKAKIQHSHGSIDIIL
NIARRKRSCLSKPARSSIWGLLGSITQIFGKSGMSSFNLSQNQGSQKARGDHRSQKRNKI
QASGSSLTPSKKWNVSTRCLRLKVKVGKEICQSTLNVVVPKVADTMGSNDIVVGDDISES
YPTKNSEFPILAHEDEDIFGEEGTQRQFQCLDSNPEEVVKHPGNSILDVHFASQELKATV
ITDNAAGDVADGNSAHKGVGILGGASESNYVDPGTSPDSEVINTAPDSEVGTRSKEGSHK
VVLTSSEIFAAPGNVTSSRRGKKKTNLLFAGNCSLHDDSPVAASKVKPPKKRGGRQKLED
GSHSSDSLVAFPVTYASSNSSSGKEFCGELLPSSRDSEPGIIEEAMVPSVKCKGSELSKS
LKSGGRKKGRSKVSNSAKSRRRKASTQRGNQRKSVNKNEVKEKGVLAAKRRDEGVLELVE
EKTEVRPQIDDIGKTDSGNNSMSVDVSNAEITSGGEPEHYCPPESAWVRCDDCYKWRRIP
VSVADLIDENCRWVCKDNMDTTFADCSIPQEKTNADINAELGLSDYEEEDGLINYNTSGK
GLDFQSTPGSSFRRIDSNVFLHRSRKTQTIDEVMVCHCKPPLDGRLGCRDECLNRMLNIE
CVQGTCPCGDLCSNQQFQKRKYAKMQWRPCGKKGYGLESLEDILTGKFIIEYIGEVLDMQ
AYEARQKEYAANGHKHFYFMTLNGSEVIDACAKGNLGRFINHSCDPNCRTEKWLVNGEIC
IGLFAMRDIKEGEELTFDYNYVRVFGAAAKKCHCGSPQCRGYIGGDPLNTEIIYQGDSDE
EYPEPLMLEDGETGDGFKTMSRTSPFYGDRTQISEAIAEDTNKMDDSATAVGQLEISGNV
NDSKSQSIPVIPQLLHSLEREDSKGKCPLLQSLETSLVVENESSIPVSSVQQKETMNKTS
SVIPQVETSLPALISGNLFTDGSDAGRKSKSDIVEDNQSLPKSHPRIKTSRKSGSIKKGK
VDGSPLSGNKVKSVASKSQVFFIKPKKIMEGSSNGRFEAVQEKLNELLDAEGGISKRKDA
PKGYLKLLLLTAASGGSGNGESIQSNRDLSMILDALLKTKSRVVLMDIINKNGLQMLHNM
IKQYRRDFKKIPILRKLLKVLEYLAVREILTRNHITAGPPCPGMESFRGSILSLTEHDDK
QVHQIARSFRDRWIPKPFRKHSYKDRDDSGMDIHRVANCNRLPMLHNHRRDESLRPSEAI
DCVMQSLVAKTSVDSAANEAGSSPGAGGCQTNGPKVRKRKSRWDQPAETNLDSIKHKKLM
LESRVLPSREDINCPDHIHNHCNKDEAVSSEDGGQITQEDVPPGFSSPFNPPLVSSDSSS
TTDLSQQNVSQLRCAFDVAIAHPQGKFNSRLPVSYGIPLHILQQFGSSQAETVDSWVIAP
SMPFHPFPPLPPFPRDKKDTPPASAVSCKTIDGPAEEWQQDSNHGPSCCPDEDNPSMTGA
NQSDADIPGTDGQHTFKRMRGSSNDLGKRYFRQQKRKGPPWLWRRNELRSSYCSQDVSCR
VDKPVSSFIQRPPQQNHH
NT seq 7437 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtgtgagaatttgacatcagttgatgaaccctcgtgtaactctgtttttgaa
cagcattcgagcttgaaatttatggaagaaccagtttctgagcagaggatgtgtttgaaa
acaagatttgatgtgcttgatgctaatgtgagtggcagtacgaagttggatgggcgtttg
ggtttgtctattgatgataccactcattgtgtgagctgtggagatgctggagatactggc
attggtaataaagatgggctgattgatgagtttcagaatgtggtgggtgtgagtttggag
aaagcgatagatgatgaatgtggggttagcagggtttgcttcattgagagtcaggaggaa
attggtgtttgtagttccccaggtaggtgtttggatttgtctcaagatggaaacaatagt
tatgtaagttctgcttatgttacagaggctgttgttggtgatagagatgggtcagtaagt
aagtgtgataacgtgtctgggtcgggtttggagaaattggttgatgagagtcagagtaaa
gtagattctgaggctgttgttggtgatagagatgggccagctagtgagtgtaataatgtg
tctggtttggttttggagaaattggttgatgaggagcagggggtttgtttggatgggagt
cagagtgaagtagatgtttgtggcaatgggttgtgtgtggagaaaggagggtttcaaggg
gaggatttggaatcatttaagcatcagaaattgcccttgggagaagtgcctagcaactgt
tcaccgagaaattgtgatcgacgggataagcagaaggatgatcaagggttcaatcgttcc
tctgttgaagagactgtagaggttacgggagtggaaactaatgctttagctgaggtaaag
ttgggcaatgataaccaaacattatcatctgatgcctatgaaatgcccttgaaatcaatt
cctgttggtgggttgacaagaaattgtgttcaacagcatgggcagaagggtgataatatt
cttagttgtctccctggggaggaaggggttatgataaagaaaagtgatgagttagctgag
ttggagaaagtgccttgtgacttgattatgccttttggaagctttgggattcccttgact
ggatcacctagaaattttgttcaacacggcgatcagaaagatggtaggactgtcagttgt
tcctcttcagaaggggatatggaaggcaaggaagtgaaaactgatgccctagacgagata
gagaaagttaactgtttccagatttcgccatcacaattttgtgaaatgcctccagaatta
ttacccttcactggttcacctaataattctgttcaacaggaagatcagaagaatgataac
actgctggttgtacctcttctgaaggggatatggaatgcatagaagaaaaaactgatgct
ttatctgggaaaatgaaagttacgtgtgaccaaatgttgccttctcaatgttgtgaaatg
gattcagaagctatatctctggttgattcacctacagattgtgttcaactgggtaatcaa
gagaataataagaatggcggttctctctcctccaaaagtgctaaggaggttatagaagat
aaaatgggtacatgtggccaaattttgccctcacagggctgttcaatgaccccagaatta
atacctaagactgattcactgagaaattgtactcaacagaatgagcagaagagcaacgag
tgcatctgtgttccatccttggaagaagaagggaaaaattatgcttcacttggaatagag
atagatatttgtgggcatatgctgtctttccaggaatgtgagattcgctcagagtcgaca
cttgtgactgagaaacaattaattgttgaagcgaagagagatattgtacatgggttagag
aatgatagtggccacccaagatcacctttagagcatactgaaccgcgcatggaatttgca
tctgcaacagacttgtcatttcgttgtattcaaaaaaaggagcagcagggcattgagagc
ttagcagaagggaaagccaatctgtcagcggctgtagaagctaatatgtggaaagccaat
ctggcagcggctgtagaagctaatatgtgcaactgcatatcagcttcacaggatggtgaa
acgcctttcaaagttttttatgaggatgatttaatgagaacttgtgaaggacataaggat
catgtggatcatgaaagcattggtcatctcgctgttggaactgtggagcaaaaagataac
actgacacatgcatcctagcattgcctatgcagagttgccagagctccttggaaagtttg
cgtatagctgattcactgagtaattgttcccagcagaatgaccaagggaataataagagt
gttgatggtctttctgcagagagtgctacagaggccgtggaagagaaaagtgatgttaca
actgatatcaaggttgagatttgcagtcagctatcaccaatagaagaaaatgaaaaggag
cactcctccagagttattgagaaaccaatttctttgcagtcatgccaaccctttgctgta
gacgagaatggctcttgtaagagtttaaatgttgcgggtctctctcaaaaagatggtttt
ggtgctattagttctagtggtgcggttgatggttttggacagatcaatcatgaagtaaaa
gatgatgtgggcacgaattgcttttctgaaactaaatatcctaacagggtatcattatct
tctagaaggagcagccgtataagtagatctagccagaagactcagaccaaaagggctgcg
aggaattgcaggactaaggccaaaattcaacattctcatgggagtattgatataatcctc
aacattgcaagaaggaagagaagctgtttgtccaaaccagctcgttcttctatctggggg
ttattgggcagcattactcaaatttttggtaagagtggcatgagtagtttcaatttatct
cagaaccaaggatcacaaaaggcaagaggtgaccatagaagtcaaaagcggaataagatt
caggctagtggaagctcattgacccctagtaaaaaatggaatgtttcaactcgatgcctt
cgtttgaaggttaaagtggggaaggaaatttgtcaaagtactctgaatgttgtggtcccc
aaggtggctgacacaatgggatccaatgatattgttgttggtgatgacatttctgagtca
taccctacaaaaaattctgagtttccaatattagcccatgaagatgaagatatatttggg
gaagagggcactcaaagacagtttcagtgtttggatagtaacccggaggaggtagtgaaa
cacccaggtaactctatcttggatgtgcactttgcaagtcaggaattgaaggccactgtg
attacagacaatgcagccggggatgttgcagatggtaattctgcccataaaggggttgga
atattgggtggagcaagtgagagcaattatgtggatcctgggacttcaccagattctgaa
gttatcaatacagctcctgattctgaagttgggactagaagtaaagaaggctcgcataaa
gttgttttgacttcctctgaaatctttgctgctcctggaaatgtcaccagcagccggaga
gggaagaagaaaactaacctcctttttgcaggtaactgtagtctgcatgacgattcacct
gttgcagccagcaaagttaaaccaccaaaaaaacgtggtggcagacagaaactggaagat
ggtagtcactctagtgattctctcgttgcatttcctgtcacttatgcttcaagtaattca
tcaagcggcaaggaattttgcggcgaactgttgccttcatcgagagacagtgaacctgga
atcattgaagaggctatggttccttcagttaaatgcaagggatctgagcttagcaaaagt
ttaaaatcgggtggaaggaaaaagggaaggtccaaagtctctaactcagctaagagcagg
agaagaaaggcttctacacagaggggaaaccaacggaagtcagtcaacaagaatgaagtc
aaggagaagggtgttttagctgccaaaagaagggatgaaggtgttttggagctggttgag
gaaaaaacagaagttcgaccacaaatagatgatattgggaaaacagattctggcaacaat
agtatgtctgttgatgtatcaaatgcggagattacatcaggtggtgaacctgagcattat
tgtcctcccgaaagtgcttgggtgcggtgtgatgactgttacaaatggcggcgtatccca
gtttcagttgcggatttgattgatgaaaactgcagatgggtctgtaaggacaacatggat
acaacatttgctgattgttcaattcctcaagaaaagacaaatgctgatattaacgctgag
ttaggcttatcagactatgaagaagaagacggccttataaattacaatacatcaggaaag
ggtttggattttcagagtacacctgggtcatcatttaggcgcattgattcaaatgtcttt
cttcatcgtagtcgtaaaacacaaacaattgatgaggtaatggtttgccattgcaaacca
cctttagatggtcggctcggctgtagagatgaatgcttgaatcggatgcttaacattgaa
tgtgttcaaggcacttgtccttgtggtgacctatgttcaaatcaacagttccagaaacgc
aagtacgccaaaatgcagtggcgtccatgtgggaagaagggttatggactagagtcactt
gaggatatactgacagggaaatttattattgaatatattggagaggtccttgacatgcaa
gcttatgaggcacggcaaaaggagtatgcggccaatggtcataagcatttttacttcatg
acattaaatggcagcgaggtaatagatgcatgtgccaagggaaatctgggccgtttcatt
aaccatagttgtgatcctaactgccgtactgaaaagtggctggtgaatggagaaatttgt
atcggactatttgcaatgagggatattaaggagggtgaagagctgacatttgactacaac
tatgtcagagtgtttggggctgctgccaaaaaatgtcattgtggttctcctcaatgccgg
ggttatataggtggggacccgctaaatactgaaataatttatcaaggtgattcagatgag
gagtatcctgaacctctgatgcttgaagatggtgaaactggagatggtttcaagacaatg
tccagaaccagtcccttttatggtgacagaacacaaatttctgaagccatagcagaagac
acaaataaaatggatgattctgccacagctgttggacaattggagatttctggaaatgtt
aatgactctaagagtcaatccattcctgttattccccaattactccattcattagaaagg
gaggattcaaaagggaaatgtcctctacttcagtcactagaaacttctcttgtggtagaa
aatgaatcaagcatacctgtatcttccgttcagcagaaggaaacaatgaataaaacttca
tctgtaatcccacaggtggagacttctttgccggctctgatatctgggaatttgtttact
gatggaagtgacgctggtaggaagtccaagtctgatattgttgaagacaatcaaagtttg
ccgaaatctcatcctcgtataaagacttctcgtaaatctggatctattaagaaaggcaag
gttgatggtagtcctttaagtggaaataaagttaagtcggttgccagcaaatcccaggtt
ttctttatcaaacccaaaaagataatggaaggttcctctaatggtcgttttgaagcagtt
caggagaaattaaatgagttgctggatgctgaggggggcattagtaaacgtaaagacgct
cctaaaggctatttgaagcttctgcttttgactgctgcttctggtggtagtggcaatggc
gaatcaattcagagcaatcgagatttatcaatgatccttgatgctcttctgaaaacaaaa
tcacgagtggtgttgatggatataatcaacaaaaatggtttacagatgctacacaacatg
atcaagcagtacagaagggacttcaagaagattccaattcttcggaagcttctgaaggtc
ttggaatatttggcagtgagagagatacttacacggaatcatattactgctggtcctcct
tgtcctgggatggagagctttcggggatcaatattgtcattgacagagcatgatgacaaa
caggttcatcaaattgcacgtagcttccgagatagatggattcctaaacctttcagaaaa
catagctacaaggacagggatgatagtggaatggatattcacagggttgcaaactgcaac
aggctcccaatgttgcacaatcatcggcgtgatgaaagtttaagaccttcagaagcaatt
gattgtgtcatgcagtcattggttgcaaaaacttctgtggattctgctgccaatgaggct
ggttcttcccctggtgcaggagggtgccagaccaatggccccaaagttcgtaaacgtaaa
agtcgatgggatcagcctgctgagacaaacctagattcaatcaagcacaagaaattgatg
ctcgagtcgagggtgttaccgagtagagaggacatcaattgtcctgatcatattcacaat
cactgtaacaaagatgaagctgttagctccgaagatggaggacagatcacacaagaggat
gttccacctggtttttcatctccgtttaaccctcctctggtttcatccgattcttcatca
actactgacctgtctcaacaaaatgtttcacagttgagatgtgcatttgatgtggctatt
gcacatcctcagggaaaattcaattcccgcctacctgtgtcttatggaattccattgcat
attttgcagcagtttgggtcatcccaggctgaaactgttgatagttgggttatcgctccc
agcatgccttttcatccttttccacctttacccccctttccccgtgataagaaagacact
ccacctgcctctgctgttagttgtaaaaccattgatggacctgcagaagaatggcaacaa
gatagcaatcatggacccagttgctgtccagatgaagacaatccaagcatgactggagct
aaccagtcagatgcagacattccgggcacagacggacaacacacgtttaaaagaatgagg
ggatcctctaatgatctgggaaagaggtacttcaggcagcaaaagaggaagggaccccct
tggctttggaggagaaatgagcttagaagttcttattgttcacaggatgttagttgtagg
gtggataaacctgtcagtagttttattcagcgtccaccacaacaaaatcatcattga

DBGET integrated database retrieval system