KEGG   Citrus sinensis (Valencia orange): 102625904
Entry
102625904         CDS       T02983                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:cit00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    102625904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cit01001]
    102625904
Enzymes [BR:cit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102625904
Protein kinases [BR:cit01001]
 Serine/threonine kinases: STE group
  STE7 family
   102625904
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 APH RIO1 FTA2
Other DBs
NCBI-GeneID: 102625904
NCBI-ProteinID: XP_006475342
LinkDB
Position
4
AA seq 405 aa
MYFWAAIDLNLCSVRKSRIIRTLNSQWATIYTLERRQRKEVTVNFLEEMRTKTPLKQLKL
SVPVQETPITSFLTASGTFHDGDLLLNQKGLRLISEENESRPSDYKEFDFEFSLEDLETI
KVIGKGSGGVVQLVRHKWVGRLFALKIIQMNIQEEIRKQIVQELKINQASQCSHVVVCYH
SFYHNGVISLVLEYMDRGSLADIIRQVKTILEPYLAVVCKQVLQGLVYLHNERHVIHRDI
KPSNLLVNHKGEVKITDFGVSAMLGSSMGQRDTFVGTYNYMSPERISGSTYDYSSDIWSL
GLVVLECAIGRFPYMQSEDQQSWPSFYELLEAIVESPPPTAPPDQFSPEFCSFVSACIQK
DPRDRSSSLDLLSHPFIKKFEDKDIDLGILVGSLDPPVNCPSLKF
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtatttttgggcggccattgatttgaatttatgttccgttaggaaaagcagaataatc
agaacactgaactctcagtgggccaccatttataccctagaaagaaggcaaagaaaagaa
gttactgtaaattttttggaagaaatgaggaccaagactccattgaaacaactcaagctc
tctgttccagttcaagaaacccctatcacttccttcttgactgcgagtgggacgtttcat
gatggcgatttgcttttgaatcagaagggtttgcggctaatttctgaagaaaatgaatcc
cgtccttctgattataaggagtttgattttgaattctcattggaagaccttgagacaatc
aaagtaataggaaagggaagcggtggagtagtacaactcgttcgccacaaatgggttgga
agattatttgcattgaagatcatccagatgaacatacaagaggaaatccgtaaacaaatt
gtgcaggagctgaaaataaatcaagcatcacagtgttcccatgtagttgtttgctaccac
tctttctatcacaatggagtcatttctcttgtgttggaatacatggatcgtggttctctg
gcagatatcatcagacaagttaaaacaattcttgaaccgtatcttgcagttgtttgtaag
caggttttacaaggtctcgtgtacttgcataatgagagacatgtaatacacagggacata
aagccatccaatctgctggtaaaccataaaggggaagtaaaaattacagattttggtgtg
agtgccatgctaggtagctctatgggtcaaagggatacatttgttggaacctacaactat
atgtcgcctgaaagaattagtgggagcacttacgactatagcagtgatatatggagtctg
ggcttggtagtacttgaatgtgctattgggcgtttcccttatatgcaatctgaagaccag
caaagctggccaagcttttatgagcttttggaggccattgtggaaagcccaccaccaact
gctccaccagatcagttctccccagaattctgttcatttgtatcagcctgcatacagaag
gatcctcgagataggtcatcatctttggacctcctgagtcaccctttcatcaaaaagttt
gaagacaaggacattgatcttggcattttggttggcagcttggatcctcctgtcaattgc
ccaagcttgaagttttag

DBGET integrated database retrieval system