KEGG   Citrus sinensis (Valencia orange): 102626642Help
Entry
102626642         CDS       T02983                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cit00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102626642
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102626642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102626642
NCBI-ProteinID: XP_006488000
LinkDB All DBs
Position
8
AA seq 234 aa AA seqDB search
MQAAIAAMAHVLLVAAPPSSSHTLLATLPNPSSITRSSSSSSSHSPSLHSAFHGVSLKFP
SRLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDGGPTTVNVRVTGLTP
GPHGFHLHEYGDTTNGCMSTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGVAEATIV
DNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgcaatagcagccatggctcacgttctcctcgtagcagcaccgccctcttca
tctcacacactccttgccacattgccaaatcctagcagtatcacgcgctcttcctcttct
tcttcttctcattctccctcgcttcactctgcattccacggcgtctccctcaaattcccc
tctcgtctcaacttatctctcgccgccgtggcctccaagaagccgttgactgtcgttgct
gccgccaagaaagcggtggctgttcttaaaggcacttccaatgttgaaggagttgttacg
ttgacccaagaagatggcggtcctacgactgtcaatgttcgtgttactggtcttactcct
gggcctcacgggttccacctacacgaatatggtgatacgacaaatgggtgtatgtcaaca
ggagcacatttcaatcctaataacatgacacacggtgctcctaaagatgaagtgcgacac
gcgggtgacctgggaaacatagttgctaacgccaatggtgtggcagaagcaacaattgtg
gacaaccagatatcactggatggtccaaacacagtagttggaagagcctttgtggttcat
gagcttgaggatgaccttggaaaaggtgggcatgaacttagtctaaccactggcaatgca
ggtggaagactggcatgcggtgtcgttggcttgactccggtatga

DBGET integrated database retrieval system