KEGG   Citrus sinensis (Valencia orange): 102628615Help
Entry
102628615         CDS       T02983                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00562  Inositol phosphate metabolism
cit01100  Metabolic pathways
cit04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102628615
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102628615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cit01009]
    102628615
Enzymes [BR:cit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102628615
    3.1.3.48  protein-tyrosine-phosphatase
     102628615
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     102628615
Protein phosphatases and associated proteins [BR:cit01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    102628615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc DUF4573 Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 102628615
NCBI-ProteinID: XP_006494490
LinkDB All DBs
Position
Unknown
AA seq 674 aa AA seqDB search
MDSDSADSASQLCATSSETEAPANVPDTNSPAEVSNMKHPDKDSDVEPLVEASDIEPPAE
AKNVEDPMKASDIEPHAKVSNVEAPHKASGIELAAATQTGGIIPSNISSWAKTLKFPQPV
PPPQDNMQTGSPRMSPFARFTSELGLRLPSMTPVADKSAEGTSTTNPTGVLESLTKGLVD
SSRSAVKAVQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGFFGYFEG
LYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDAALFQGKVACFPFDDHNCPPIQLIASF
CRSAYSWLKEDILNVVVVHCKAGMARTGLMICSLLLFLKFFPTAEEAIDYYNQKRCVDGK
ALVLPSQIRYVKYFERILTYSNGEIQPARRCMLRGFRLLQCPYWIRPSIAIFNHSGILFS
TRKHPKTKDLMPEDFWIKAPKKGIVVFALPGEPGLTELVGDFKVLFHDRQGDFYCWLNTT
MTENRKILDGSDLDGFDKRKVPSPGFQVEIVMIDYDGILPTKTKSDSANRRQDCSTDYAS
VPTGGATIGPNHRKVTKSEDNDDVFSDSDGEEADTSKSRQADAASGGESAPHGILSNSMA
DNVPQSQRSGHLSLSNEKPKVKNVSKEPTTDGVREPASSLPMPNLDSMGASDIKSMAADA
SVFSFGDDEDYESE
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggattcagattctgcagactcagcttctcaactgtgtgccacatcttctgagactgaa
gctcctgcaaacgttcctgataccaactctcctgctgaagtgtccaacatgaaacatccc
gataaagattctgatgtcgaacctctagtagaagcttccgacattgaacctcctgctgaa
gccaaaaatgtcgaagatcccatgaaagcttccgacattgaacctcatgctaaagtttca
aatgttgaagctccccataaagcttctggcattgaacttgctgcagctactcaaactggg
ggcattattccttcaaacatatcatcttgggctaaaactttgaaatttccacagcctgtg
ccacccccacaggacaacatgcaaacgggaagtcctaggatgtcaccatttgcacgtttc
actagtgaactaggattacgtttgccctcaatgactcctgtagcagacaagagtgctgaa
ggtacttcaacaacaaacccaactggtgttcttgagtcattaacaaaaggtttggttgac
tcatctaggagtgcagtaaaggccgtgcaggtcaaggcacgccatattgtctctcaaaac
aaacgaaggtaccaggaaggagaatttgatttggacatgacatacatcactgaaaacata
attgctatggggttcccggctggtgacataagctctgggttttttggatattttgagggg
ctgtatagaaatcacatggaagaagtgatcaagttttttgaaactcatcacaagggaaaa
tacaaggtgtacaatctctgttctgaaaggttgtatgatgcagcactatttcaggggaag
gtcgcatgcttcccatttgatgaccataattgcccccctattcaactcatagcatcattt
tgtcgaagtgcatactcatggttgaaggaggacatcttaaatgtggttgttgttcattgt
aaagcaggtatggccagaacaggattaatgatttgcagccttcttttattccttaagttc
ttccccacagcagaggaggccattgattactacaaccagaaaagatgtgtagatgggaaa
gctctggttcttccaagtcagattaggtatgtcaaatactttgaacgtatcttaacgtac
tccaatggagagattcagcccgcacgtaggtgcatgctcaggggatttcggcttcttcaa
tgcccttattggatcaggccttctatagctatctttaatcacagtggaattctgttctca
acgagaaaacatccaaaaactaaggatttaatgcctgaggacttctggattaaagcacca
aagaaagggattgtggtatttgctttgccaggggagcccggtctaacagaactggtgggg
gacttcaaagtccttttccatgaccgccaaggggatttctactgttggttaaacacaact
atgaccgagaacagaaaaatattggatggttccgatcttgatggttttgacaagagaaaa
gtgccttctcctggattccaggttgagattgtgatgatagactatgacggtatcttacca
acaaagactaaatctgattccgccaatagaagacaagactgtagcacagattatgcttca
gttccaactggtggtgctacaattggtcccaatcacagaaaagtcactaaaagtgaagac
aatgatgatgtgttctcagatagtgacggagaggaagccgatacttcaaagagcaggcag
gctgatgctgcttctggaggggaatcagctccgcatgggatattatctaattccatggca
gataatgtgccacagagtcagagaagtggacatttgtctctcagcaatgagaagccaaaa
gtgaaaaacgtttccaaagaacccaccactgacggggtaagagagccagcctcatccctg
ccgatgccaaatctggactctatgggggcaagtgatatcaaatcaatggctgctgatgct
tcagttttcagctttggagatgatgaagattatgaaagtgagtaa

DBGET integrated database retrieval system