KEGG   Cellvibrio japonicus: CJA_1983Help
Entry
CJA_1983          CDS       T00721                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
cja  Cellvibrio japonicus
Pathway
cja00020  Citrate cycle (TCA cycle)
cja00270  Cysteine and methionine metabolism
cja00620  Pyruvate metabolism
cja00630  Glyoxylate and dicarboxylate metabolism
cja00680  Methane metabolism
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01120  Microbial metabolism in diverse environments
cja01130  Biosynthesis of antibiotics
cja01200  Carbon metabolism
Module
cja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cja_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJA_1983 (mdh)
   00620 Pyruvate metabolism
    CJA_1983 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    CJA_1983 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    CJA_1983 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CJA_1983 (mdh)
Enzymes [BR:cja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CJA_1983 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ACE83216
UniProt: B3PHI3
LinkDB All DBs
Position
complement(2299174..2300157)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVTVTGAAGQISYSLLFRIAAGDMLGKDQPVILQLLEITPALKALQGVAMELDDC
AFPLLAGIVTTDDPSVAFKDSDYALLVGARPRGPGMERKDLLAANAAIFSVQGKAINDHA
SKNIKVLVVGNPANTNALIAQRNAPDISPRQFTAMTRLDHNRALSQLATKTGTSINNITK
ALIWGNHSSTQYPDLHNTLVDGKPALSLVDQAWYESDYIPTVQQRGAAIIAARGASSAAS
AANAAINHIRDWALGTPANDWVSMGVYSDGSYGIEKGLIYSFPCVCKNGDWEIVQGLDIN
EFSRAKMTATEKELQEERDAVKELLPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacctgtaagagttaccgtcactggcgccgctggtcaaatcagctattcgctt
ctgttccgtatcgctgctggcgatatgttgggcaaagatcaaccagtaatcctgcaatta
ctggaaatcaccccggccctcaaagcgctgcaaggcgtggctatggagctggacgactgt
gctttcccgctgctggccggcattgttactactgacgatccgtcagttgccttcaaagat
tctgattacgcattgctggtgggcgcgcgtccacgcggcccgggcatggagcgtaaagac
ctgctggctgctaacgccgccatcttctctgtacagggtaaggccatcaatgatcatgcg
tccaaaaacattaaagtgctggtagtcggtaaccctgccaacaccaatgccctgattgcc
cagcgcaatgccccggacatcagcccacgccagttcactgccatgacccgcctggatcac
aaccgtgcactgtcacaactggctaccaaaaccggtaccagcatcaacaacatcactaag
gcgctgatttggggtaatcactcctctacccagtatcctgacctgcacaacaccctggta
gatggcaagccagcactgagcctggtggaccaagcctggtacgaaagtgactacatcccc
accgtacaacaacgcggtgctgccattatcgctgcacgcggtgcttcttcagccgcatct
gccgctaacgctgcaatcaaccacatccgcgattgggccctgggtactccagcaaacgat
tgggtgagcatgggtgtttacagcgatggttcttacggcattgaaaaaggcctgatttat
tctttcccttgtgtatgcaaaaacggcgactgggaaattgtgcaaggcctggatatcaac
gaattttcgcgcgcaaaaatgactgcaactgaaaaagaattgcaggaagagcgcgatgca
gtgaaagagttgttgccagcgtaa

DBGET integrated database retrieval system