KEGG   Cellvibrio japonicus: CJA_2663Help
Entry
CJA_2663          CDS       T00721                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
cja  Cellvibrio japonicus
Pathway
cja00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01130  Biosynthesis of antibiotics
cja01230  Biosynthesis of amino acids
cja02024  Quorum sensing
Module
cja_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJA_2663 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CJA_2663 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CJA_2663 (trpE)
Enzymes [BR:cja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CJA_2663 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ACE85614
UniProt: B3PLP3
LinkDB All DBs
Position
complement(3131832..3133346)
Genome map
AA seq 504 aa AA seqDB search
MHGDTAAGSKGNVMNYDAFSQLADQGYNRIPVVREVLADLDTPLSSYLKLASGPYSYLFE
SVQGGEKWGRYSMIGLPARTVLKAFGEDIVIERDGKVIESHQCADALAFVEEFKQRYRAP
ELPGLPRFTGGLVGYFAYDCARYVEPHLKASAPRDVIGTPDILLSVSDEVLVFDNLAGKL
ILVIHANPEVENAFVKANARLDELEQRLRGEMPVTSGLSLGTDGHSEARFQSHVGESSFH
KMVDRIKDYVLAGDTMQVVISQRLSIDFPQEPINLYRALRHLNPSPYMYFLDLGDHHVVG
SSPEILARLEDGEVTVRPIAGTRRRGRTPEEDRALEVELVNDPKEIAEHLMLIDLGRNDI
GRVAQVGSVTLTDKMVVERYSHVMHITSNVTGQLKPELKAMDVLRAALPAGTLSGAPKIR
AMEIIDELETEKRGIYGGAVGYIAWNGNMDTAIAIRTAVIKDGKLYVQAGAGVVADSVPA
LEWKETMNKARAIFKAVDMVGDAQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgcatggcgatacggcggcaggttccaaaggtaatgtcatgaattacgatgcttttagc
caattggctgaccaaggctataaccgtattccggtcgtgcgtgaggtattggcggatctg
gatacccctttgtcttcctacctgaaactggcttccgggccctattcctatttgttcgaa
tcagtgcagggcggcgaaaagtgggggcgttattcgatgattggcctcccggcccgcacc
gtattaaaagcctttggtgaagatattgtgattgagcgcgatggcaaggtcattgagtcc
caccagtgcgccgacgccctggcatttgtagaagagttcaagcagcgttaccgcgcacct
gaattgcctggtttgccgcggtttaccggtggcttagtgggatattttgcctatgattgc
gcgcgctatgtggagccgcaccttaaggccagtgcccccagggatgtaatcggcacaccg
gatatcctgctcagcgtatctgatgaggtactggtgttcgataacctcgccggcaaactg
atcctggtgatccatgccaatcccgaggtggagaatgccttcgttaaggccaatgcacgc
ctggatgaattggagcagcgcctgcgcggtgaaatgccggtaacatccggtttaagcctg
gggacggatggtcatagcgaggcccgtttccagtcccatgtcggtgagtccagcttccac
aagatggtggatcgtatcaaggactatgtattggctggcgatactatgcaggtggttatc
tcgcagcgcctgtcgattgattttccccaggagcccatcaacctgtatcgcgcgttgcgc
cacctcaatccatcgccttatatgtacttcctcgacctgggtgatcaccatgtcgtaggt
tccagcccggaaatcctggcgcgcctggaagatggcgaagtgactgtgcgccccattgcc
ggcacacgtcgtcgtggtcgtacaccggaggaggatcgtgcgctggaagtcgagttggtc
aatgacccgaaagagattgctgagcatttgatgctgattgacctgggacgcaacgatatt
ggtcgcgtggcccaggtgggcagtgtgacactgactgacaaaatggtggtggagcgctac
tcccatgtgatgcatatcacctccaatgtcaccggccagctcaagccggaactcaaggcg
atggatgtcttgcgcgctgcccttcctgcgggcactttgtccggtgcaccgaaaatccgt
gcgatggaaatcattgatgaactggaaacagaaaagcgcggtatctacggtggtgcggtg
gggtatatcgcctggaatggcaatatggataccgccattgccatacgtacggccgtgatc
aaagacggcaagctctatgttcaggccggtgccggtgtggtggctgattcagttcccgca
ctggaatggaaagagacgatgaacaaagcgcgcgccatctttaaggcggttgatatggtg
ggagatgcacaatga

DBGET integrated database retrieval system