KEGG   Cellvibrio japonicus: CJA_3126Help
Entry
CJA_3126          CDS       T00721                                 

Gene name
amy13I
Definition
(GenBank) alpha-amylase, putative, amy13I
Organism
cja  Cellvibrio japonicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ACE84223
UniProt: B3PDS3
LinkDB All DBs
Position
3711848..3713668
Genome map
AA seq 606 aa AA seqDB search
MIKNVIMAAAICAAVAPVTQAATEQSKSSSAILLQGFHWNSHNSAWYTTLQNNAQSIADL
GVTHVWFPPPSDAASNEGYLPRQLNILNSKYGSEAQLTSAISALKSKGVNSVADVVINHR
VGTTNWADFTNPTWGSWAVTCNDEWSGATGECDTGDGYAAARDLNHINSTVQADIINWIN
QRLKGVGFTGIRYDYSKGYAPYYAGLYARATNPDFCVGEVWTDLNYNNVNAHRQLLMDYV
NGTDGDCGVFDFTTKGLLNQALSYNEYHRLSISNAPAGGIGWWAQKMVTFVDNHDTGPSE
SCGVGQNHWPVPCDKVMQGYAYVLTHPGIPSIYWAHAYNWGLYNGIKALVDIRKAQGITS
TSSVSIAAATTGLYAAVIDGKVAMKIGPNAWSPSGTGWTLAASGTNYAVWTKGTTQQADW
KRTVVFVYGVTSSGQDMFIRGGIDHGYASNTLGKTCTNTNFECAIPIRHNNLRNATTAPW
KTNDNYLDWYGTESGQSSAAQGTAADWTTNVWPSSWGTKRTTAVDGYGEDPLNLYGQHYW
MMDVDMDCSKTVNGWFELKTFISNGPGWEADVSQSGTPYASGNHFAQCGKINVFQRGSSS
ATFVNF
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaacgtcatcatggcagcagccatctgtgctgctgtggcgcctgttacccag
gctgccacagagcaaagcaaatccagtagtgcaattctcttgcaaggttttcactggaat
tcccacaacagtgcctggtacaccaccctgcagaacaatgcccaaagcattgctgacctg
ggcgtcacccatgtgtggttcccgccaccctcggatgccgcttcgaatgagggttacctg
ccgcgccagctgaatatcctcaactccaaatacggtagcgaggcacaactgacatcggcg
atttcggcactgaaatccaaaggcgtcaactcagtagccgatgtggtgatcaaccaccgc
gtgggcacgaccaactgggctgactttactaacccgacctggggttcctgggccgtcacc
tgtaatgatgagtggagcggtgcaacgggtgagtgtgatactggcgacggctatgcggcc
gcacgcgatctcaaccacatcaatagcactgtacaagcggacatcattaactggattaac
caacgcctcaaaggggtcggttttaccggtatccgctacgactactccaaaggctacgcg
ccctattacgccggcctttacgcacgggcaaccaaccccgacttttgtgtgggcgaggtg
tggaccgacctcaactacaacaacgtcaatgcacaccgccagttgctgatggattatgtc
aacggcactgacggtgactgcggcgttttcgacttcaccaccaaggggctgctcaaccag
gcactcagctacaacgagtaccatcgcctgagcatcagcaacgccccggccggcggtatc
ggttggtgggcacagaagatggtgacctttgtggataaccacgataccggcccgagcgag
tcctgcggcgtcggccagaaccactggcccgtgccctgcgacaaggtcatgcaaggctat
gcctatgtgctgacccacccgggtattccctccatctactgggcacacgcctacaactgg
gggctgtataacggcatcaaggcattagtggatatccgcaaggcccagggcatcacctca
acctccagcgtcagcattgcggcagcgaccaccggtctctacgccgcggtgatcgatggc
aaggtggcgatgaaaatcggccccaatgcctggagtccgagcggtaccggttggaccctg
gccgccagcggcaccaactatgctgtctggaccaaaggtacaacccagcaagctgactgg
aaacgtaccgtggtatttgtgtacggtgtgacctcctccggccaggatatgtttatccgc
ggtggtatcgaccatggttatgccagcaacacgctgggcaaaacctgcaccaacaccaac
tttgagtgcgccattcccatccgccacaacaacctgcgcaacgccaccacagcgccatgg
aaaaccaacgacaattacctcgattggtatggcaccgagtcaggccaaagcagtgccgca
cagggtacggcggcggactggaccaccaatgtctggccaagctcctggggcaccaaacgc
accacggcagtggatggttatggcgaagacccactcaacctgtacggccaacattattgg
atgatggatgtggatatggactgcagcaaaaccgttaacggttggtttgagctgaagacc
tttatcagcaacggaccaggttgggaagccgatgtgagccagagcggtacgccctacgca
tccggcaaccacttcgcccaatgcggtaagatcaatgtgttccagcgtggcagctccagc
gccactttcgttaatttctag

DBGET integrated database retrieval system