KEGG   Cellvibrio japonicus: CJA_3254
Entry
CJA_3254          CDS       T00721                                 

Gene name
glgC
Definition
(GenBank) Glucose-1-phosphate adenylyltransferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
cja  Cellvibrio japonicus
Pathway
cja00525  Acarbose and validamycin biosynthesis
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cja00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    CJA_3254 (glgC)
Enzymes [BR:cja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     CJA_3254 (glgC)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: ACE85874
UniProt: B3PEF2
LinkDB
Position
complement(3890354..3891412)
AA seq 352 aa
MNKLLGILLAGGKGQRLKQLTRELPKPLVPYAAQCRMIDFSLQNCVDSGVQEVMLLSKHM
ETLIHQYLLAEWTHKIKIHFGPYQALHHQPAETVYASVQKPDEQGTADALLNGREYICRD
GYEDVLILHSDHIYHYDFKKMYELHQSSKAALTIGYQEIPLEYVKLFGMSRFDTDGNLVE
FVEKPANPTANTVFTAVCIFNIRLMYQYLDQLKHTEWRHDISHDLIPAMLRNGEIIKGIC
FEDYWEDIGTTERFYKAHLNLVNGKIRLLPPQTLSDAKEVRLIDDEKRNRVLADSRVIRV
DFKAENSVIFPGARIGEQCFIKNSVIMPDAELPAGTHISNALVSQGHIEYFH
NT seq 1059 nt   +upstreamnt  +downstreamnt
gtgaacaaattattgggcattttgttggcaggtggtaaaggccagcgccttaaacaattg
acgcgtgagcttcccaaacccctggttccctatgccgcgcaatgtcgcatgatcgatttt
agcctgcaaaactgtgttgattccggtgtacaggaagtgatgttgctgtccaaacatatg
gaaacgctgatccaccagtatttattagctgagtggacgcacaaaataaaaattcatttt
ggcccttaccaggcgctccatcaccagcctgcagaaacggtttatgccagcgtacagaaa
ccggatgagcagggcaccgcagatgcgttgctcaatgggcgtgaatatatttgccgcgat
ggttatgaagacgtattgatcttgcactcagaccatatttatcactacgactttaagaaa
atgtatgagctgcatcaatccagtaaagctgcattgaccattggctatcaggaaatcccc
ctggaatatgtcaaattatttggaatgtccaggtttgatactgatggcaatttggttgaa
tttgttgaaaagcccgcgaacccaacggccaatacagtttttactgccgtgtgtattttc
aatatccgcttgatgtaccagtacctggatcagcttaagcacacggaatggcgccatgac
atcagtcatgatttgattccagccatgttgcgcaatggtgaaattatcaaaggcatttgt
ttcgaggattattgggaagatataggtacaaccgagcgcttttataaggcacaccttaac
cttgtcaatggcaagatccgcttgctgccaccccaaacgttatccgatgcaaaagaagtc
cgtctgattgacgatgaaaaacgcaatcgtgtcctggctgatagccgggttatccgtgtg
gatttcaaggcggaaaacagtgttatttttcccggtgcacgtattggtgaacagtgcttt
attaaaaactcggtgattatgcccgatgcagaattgcccgccggcacccacattagcaat
gccctggtaagccagggccatattgaatattttcattaa

DBGET integrated database retrieval system