KEGG   Cellvibrio japonicus: CJA_3257
Entry
CJA_3257          CDS       T00721                                 

Definition
(GenBank) homolog of 4-aminobutyrate aminotransferase GabT
  KO
K20428  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
cja  Cellvibrio japonicus
Pathway
cja00525  Acarbose and validamycin biosynthesis
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cja00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    CJA_3257
Enzymes [BR:cja01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     CJA_3257
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: ACE84099
UniProt: B3PEF5
LinkDB
Position
complement(3894930..3896228)
AA seq 432 aa
MNSIQVKTIEADYLAPGISEEARLADMAFVRGEGCYLYDAEGKAYLDFAAGIFTQNIGHG
HPQLVERLKQQVDQLWNVHDSSHPARAQLCLHLSECFPDELQRFAFFSTGAEAVEAAIRA
VLAAASPKRQRMAALRYGFHGKTQGARSLVHWDVGFSAFSGNSVLGYSANCYRCPLGRTY
PSCDMQCAMLVAKHIASKDNISALFFEPVQGAAGVIVPPKEYWDIIQRECRQSGVMLVAD
EIVTAGGRSGYFLACEYYGLKPDLVTAAKGLSSGFPFSVLAGKEALMAEGAFAAPGASSS
TYGGNPLSCTAAAATLDILKTEHVIDDVTRKGRLLGDGLKQLARDHAVIGDARGLGLLWA
LEFVSDPIAKTPDSDMAKAFYTRALALGARVCVGGNIVRIGPPLTIDDAEIQEALRIFDQ
VLGELRQARIAA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaattcgattcaggtcaagacaatagaagccgactatctggctccgggaatctcggag
gaagcacgcctggcagatatggcgtttgtgcgtggtgagggctgctatttatatgatgcc
gagggtaaagcttacctggattttgccgcggggatttttacgcaaaatatcggccatggt
catccgcaattggttgaacgtctcaagcagcaggtggatcagttgtggaatgtccacgac
tccagccatccggcgcgtgcgcaactgtgtctgcatttaagtgaatgctttccggatgag
ctgcagcgctttgcatttttttcaaccggtgcagaggcggtggaggcagcaattcgcgct
gtattagccgccgcatcaccaaagcgccaacgcatggcagccctgcgttatggcttccat
ggcaaaacccagggcgctcgctcactggtgcattgggatgtgggctttagtgctttttcc
ggcaattccgtattgggatattctgcaaattgttatcgctgtcccttgggtcgcacctat
ccgtcctgtgatatgcagtgtgccatgctggtcgctaagcatatcgccagtaaagacaat
atctctgccttattttttgaacctgttcaaggcgccgccggtgtcatagtaccacccaag
gaatattgggacattatccagcgcgaatgtcgtcaaagcggggttatgctggtcgccgat
gaaatcgtaacggcgggtggccgttcaggctattttctggcgtgtgaatattatggcctt
aagcctgacctggtgacggctgccaagggcttaagctccggttttccgttctcggtgtta
gcaggaaaagaggccttgatggcggagggggcgtttgcagcaccgggcgcatcctcgtca
acctatggcggtaacccattgagctgcacggctgctgccgcgaccctggacatattaaaa
acagaacatgtcattgatgacgtaacgcgcaaaggccggttgcttggcgatgggcttaag
caattagcgcgggaccatgcggtgatcggcgatgcgcgcggcctggggttgctctgggca
ctggaatttgtatccgacccgattgccaagacaccggacagtgacatggccaaggcgttt
tatacccgcgccctggcgctgggggcgcgggtgtgtgtgggcggtaacattgtgcgtata
gggcctccgctgacgattgatgatgcagagatacaggaagcactccggatttttgatcag
gtcctgggtgagttgcgccaggcgaggattgccgcatga

DBGET integrated database retrieval system