KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0437Help
Entry
BN148_0437        CDS       T02302                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
cjb00020  Citrate cycle (TCA cycle)
cjb00190  Oxidative phosphorylation
cjb00650  Butanoate metabolism
cjb01100  Metabolic pathways
cjb01110  Biosynthesis of secondary metabolites
cjb01120  Microbial metabolism in diverse environments
cjb01130  Biosynthesis of antibiotics
cjb01200  Carbon metabolism
Module
cjb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN148_0437 (sdhA)
   00650 Butanoate metabolism
    BN148_0437 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN148_0437 (sdhA)
Enzymes [BR:cjb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN148_0437 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BN148_0437 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO HI0933_like Pyr_redox_2 Thi4 TAT_signal UCR_Fe-S_N FAD_binding_3 Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCK66564
LinkDB All DBs
Position
405333..407168
Genome map
AA seq 611 aa AA seqDB search
MGEFSRRDFIKTACISVGALAASSSGVYALDDSSKMDKDINLPSCDVLVIGSGGAGLCAA
AAVRKENPKLSVVVATKMMPSRNATCMAEGGINGVTDFSNGDSYKLHAYDTIKGGAYLVD
QDAALKFCELAGKAIFNMDFIGTLFSRNEQGGVAQRLMGGASKKRCNYSADKTGHILMHS
CLDDAISSGVKFLMNHELLDIGVVDGKCEGVVLRDIQSGGIYPVLCKALVIATGGYTRIF
YNRTSTPFIATGDGVAAALRAGLGFEDPEMIQFHPTGVANGGTLITEAARGEGGYLLNNR
GERFMKNYHEKMELAPRDVVARAIETEIREGRGYGEGLGAYVLCDVRHLGKEKILKDLPK
IRHTAMLFENIDLVDTPVPIRPTAHYSMGGIEVAKFEDMGTKIAGIYVGGEASCISIHGA
NRLGGNSLADAVVTGHLAGIGATNYAKDASFGKGAKTHELAQKWQVRFKEITNNGGNGQE
MYELREELGSQNWDNMGIFRTQEKLDLLAKKLEDIQARYEKIRIPNPNEVMNTAFTDYVE
LGNLILLSRCACLAARNRLESRGAHTREDYPKRDDKNFLKHSIVNLENDELKLSYKDVVV
TEFSLDGRRVQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaattttctagaagagattttataaaaacagcctgtattagtgtaggagcttta
gctgcaagttcaagtggagtttatgctttagatgattcatctaagatggataaagatata
aatttaccttcttgcgatgttttggtaattggatcaggtggagcaggtttgtgtgctgca
gccgcagtgagaaaagaaaatccaaaattaagcgttgtagtagctacaaagatgatgcca
tcgcgtaacgcaacttgtatggcagagggtggaattaatggagttactgatttttctaat
ggagattcctataaattacatgcttatgatactattaaaggcggagcttatttggtagat
caagatgcggctttaaaattttgcgaattagctggaaaggctatttttaatatggatttt
ataggaaccttgttttcaagaaatgagcaaggtggagtagctcagcgtttaatgggagga
gcttctaagaaacgctgtaactattctgcagataaaacaggtcatattttaatgcattct
tgtttagatgatgctattagtagtggtgtgaaatttttaatgaatcatgaacttttggat
ataggtgttgtggatggaaaatgcgagggtgtcgttttaagagatatacaaagcggtgga
atttatcctgtgttatgcaaagctttggtgattgctacagggggatacacaaggatattt
tataatagaacttcaactccttttattgccacaggagatggtgtggcagctgctcttaga
gcaggacttggttttgaagatcctgagatgatacaatttcacccaacaggagttgcaaat
ggtggaactcttattacagaagcggcgcgcggtgaagggggatatcttttaaataatcgt
ggtgagcgttttatgaaaaattaccatgaaaaaatggagcttgcaccgcgagatgtggtt
gcgcgtgctatagaaacagaaattcgtgaaggtagaggttatggcgagggacttggagct
tatgttttgtgcgatgtacgccacttaggaaaagaaaaaattttaaaagatttaccaaaa
attcgtcacactgcaatgctttttgaaaatattgatttagtagatactcctgtacctatc
cgtccaacggcgcattattctatgggtggaattgaagtggctaaatttgaagatatgggt
actaaaattgctggaatttatgtaggtggagaagcttcttgcatttctatacatggagct
aatagactagggggaaattctttagccgatgcagttgtaacagggcatttagcaggcatt
ggtgcgacaaattatgctaaagatgcaagttttggaaaaggggcaaaaactcatgaactt
gctcaaaaatggcaggttagatttaaagaaattacaaataatggcggaaatggtcaagaa
atgtatgaattgcgagaagagctaggaagtcaaaattgggataatatggggatttttaga
actcaagaaaaactcgatcttctagcaaaaaaattagaagatatacaagcgagatatgaa
aaaattcgtattccaaatcctaatgaagtgatgaatactgcttttacagattatgtagag
cttggtaatttgattttactttctcgctgtgcttgtttagcagctagaaatagacttgaa
agccgtggggctcatactagagaagattatccaaagcgagatgataaaaatttcttaaaa
catagcattgtaaatttagaaaatgatgaattaaaacttagttataaagatgtcgtggta
actgagttttcacttgatggaaggagagtacaatga

DBGET integrated database retrieval system