KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0438Help
Entry
BN148_0438        CDS       T02302                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
cjb00020  Citrate cycle (TCA cycle)
cjb00190  Oxidative phosphorylation
cjb00650  Butanoate metabolism
cjb01100  Metabolic pathways
cjb01110  Biosynthesis of secondary metabolites
cjb01120  Microbial metabolism in diverse environments
cjb01130  Biosynthesis of antibiotics
cjb01200  Carbon metabolism
Module
cjb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN148_0438 (sdhB)
   00650 Butanoate metabolism
    BN148_0438 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN148_0438 (sdhB)
Enzymes [BR:cjb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN148_0438 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BN148_0438 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_9 Fer4_8 Fer4_17 Fer2 Fer4_7 Fer4_10 Fer4_16 Fer4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: CCK66565
LinkDB All DBs
Position
407165..408130
Genome map
AA seq 321 aa AA seqDB search
MKIIIDRFNGKEKYEQSYDIDDKDIQGKTLLSLLLFIKKTKDITLNFTASCQSAICGACA
VRVNGHSYLACDTKMQDLLKEYDNPSSIRISPLGNFRVISDLIVDWEPSIENLRKIRPAM
VAKNEFSAEKGCKQSQEEFDRISKQWDCILCGSCASECNKLEADSSDYMQPFVFTHVWRA
AADSRGKDPMLHVKPSVMNGLWLCVHCQECADRCPKGISSVSDIANLRVMAIKKGLNEGL
GPDHAEAFYKDLVEGSGRLNEIYLALRSEGVIGSMGKTDIAFKLMRAGKMNPMHVFGEGE
IEGYKDLVKMIKAAQEAAVKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcatagatcgttttaatggcaaggaaaaatatgaacaaagttatgatatt
gatgataaggatatacaaggaaaaactctgctctctcttttgctttttatcaaaaaaaca
aaagatattactttaaattttaccgcctcttgtcaatctgcaatttgtggggcttgtgca
gttcgtgtgaatgggcattcttatcttgcttgtgatactaaaatgcaagatttgttaaaa
gaatatgataatccttcaagtatacgcatttctccgcttggaaattttagagtaatttct
gatttaattgtggattgggaaccttctatagaaaatttaagaaaaattcgtcctgccatg
gtggcaaaaaatgaattttcagcggaaaagggctgtaaacaaagtcaagaagaatttgat
cgtattagcaagcaatgggattgtattttatgtggtagctgtgcttcagagtgtaataaa
ttagaagcagatagtagcgattatatgcaaccttttgtttttactcatgtttggcgtgca
gcggcggactctcgaggtaaggatcctatgttgcatgtaaaacccagcgtaatgaatgga
ctttggctttgtgttcattgtcaagagtgcgctgatcgttgtccaaagggtataagttca
gtaagtgatatagcaaatttaagagtgatggcgattaaaaaaggtttaaatgaaggctta
gggcctgatcatgctgaagctttttataaagatttagttgaaggttcaggacgcttgaat
gaaatttatcttgctttgcgttctgagggtgttataggttctatgggtaaaacagatata
gcttttaaacttatgcgtgcaggaaaaatgaatcctatgcatgtttttggcgagggtgaa
atagaagggtataaagatttggttaaaatgataaaggcggcacaagaagctgctgttaag
gagtaa

DBGET integrated database retrieval system