KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385305
Entry
100385305         CDS       T03264                                 

Gene name
GNRHR
Definition
(RefSeq) gonadotropin releasing hormone receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100385305 (GNRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100385305 (GNRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100385305 (GNRHR)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    100385305 (GNRHR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100385305
NCBI-ProteinID: XP_002745835
Ensembl: ENSCJAG00000009836
UniProt: A0A2R8M762
LinkDB
Position
3
AA seq 328 aa
MANSASPEQNQNHCLAINDSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSTTFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFFCKVLSYL
KLFSMYAPAFMMVVISLDRFLAITRPLALKSNRKLGQSMVGLAWILSSIFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFPQWWHQAFYNFFTFSCLFITPLLIMLICNAKIIFTLTR
VLHQDPHKLQLNQSKNNIPRARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRV
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcaaacagtgcctctcccgaacagaatcaaaatcactgtttagccatcaatgacagc
atcccactgatgcagggcaacctccccactctcaccttgtctggaaagatccgagtgaca
gttactttcttcctttttctactctctacaacctttaatgcgtctttcttgttgaaactt
cagaagtggacacagaagaaagagaaagggaaaaaactctcaagaatgaagctgctctta
aaacatctgaccttagccaacctgttggagactctgattgtcatgccactggatggaatg
tggaacattacagtccaatggtatgctggagagttcttctgcaaagtcctcagttatcta
aagcttttctccatgtacgccccagccttcatgatggtggtgattagcctggaccgcttc
ctggctatcacgaggcccctagctctgaaaagcaacagaaagcttggacagtccatggtt
ggcctggcctggatcctcagtagtatctttgcgggaccacagttatacatcttcaggatg
attcatctagcagacagctctggacaaacaaaagttttctctcaatgtgtaacacactgc
agttttccacaatggtggcatcaagcattttataactttttcaccttcagctgccttttc
atcaccccgcttctcatcatgctgatctgcaatgcaaaaatcatcttcaccctaacacgg
gtccttcatcaggacccgcacaaactacaactgaatcagtccaagaacaatataccaaga
gcacggctgaggactctaaaaatgacggttgcatttgccacttcatttactgtctgctgg
actccctactatgtcctaggaatttggtattggtttgatcctgaaatgttaaacagggtg
tcagatccagtaaatcacttcttctttctctttgctttcttaaacccatgctttgatcca
cttatctatggatatttttctctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399755
Entry
100399755         CDS       T03264                                 

Gene name
GNRHR2, GnRH-II-R
Definition
(RefSeq) gonadotropin-releasing hormone II receptor-like
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100399755 (GNRHR2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100399755 (GNRHR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100399755 (GNRHR2)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    100399755 (GNRHR2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100399755
NCBI-ProteinID: NP_001254688
Ensembl: ENSCJAG00000002216
UniProt: Q95MG6
LinkDB
Position
18
AA seq 380 aa
MSAVNGTPWGSSAREEVWAGSGVEVEGSELPTFSTAAKVRVGVTIVLFVSSAGGNLAVLW
SVTRPQPSQLRPSPVRRLFAHLAAADLLVTFVVMPLDATWNITVQWLAGDIACRTLMFLK
LMAMYAAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHRA
GPVPFTQCATKGSFKARWQETTYNLFTFCCLFLLPLTAMAICYSRIVLGVSSPRTRKGSH
APAGEFALRRSFDNRPRVRLRALRLALLVLLTFILCWTPYYLLGLWYWFSPSMLSEVPPS
LSHILFLFGLLNAPLDPLLYGAFTLGCRRGHQELSMDSSREEGSRRMFQQDIQALRQTEV
QKTVTSRKAGETKDIPITSI
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtctgcagtaaacggcaccccttgggggtcctcagcgcgggaggaggtctgggcagga
tcgggagtggaggtggagggctcagagctgcccaccttctcgacagcagcaaaggtccga
gtgggagtgaccattgtgctgtttgtttcttcggctggagggaacctggctgtcctgtgg
tcagtgacacggccgcaacccagccagctccgcccctctccggtcaggagactcttcgcc
catttagcagccgccgacttactagtcacttttgtggttatgcccctagatgccacctgg
aatatcactgttcagtggctggctggggacatcgcatgtcggacactcatgttcctgaaa
ctaatggccatgtatgctgcagctttcctgcctgtggtcattggactggatcgccaggca
gcagtactcaatccgcttggatcccgctcaggtgtaaggaaacttctgggggcagcctgg
ggacttagtttcctgcttgccttgccccagctgttcctgttccataccgtccaccgagct
ggtccagttcccttcactcagtgtgccaccaaagggagcttcaaggctcgatggcaagag
accacctataacctcttcactttctgctgcctctttctgctgccactgactgccatggcc
atctgctatagccgcattgtgctcggtgtgtccagcccccggacaaggaaggggagccat
gcccctgccggggaatttgccctccgtcgctccttcgacaatcgtccccgtgtccgtctt
cgggccctgagactggccctgctcgtcttgctgaccttcatcctctgctggacaccttat
tacttactaggtctgtggtactggttttccccgagcatgctaagtgaagtccctcccagc
ctcagccacatccttttcctctttggcctcctcaatgctcctttggatcctctcctctat
ggggccttcacccttggctgccgaagagggcaccaagaacttagtatggactcttctagg
gaagaagggtctaggagaatgttccaacaggacattcaggcccttagacaaacggaggta
caaaaaactgtgacatcaagaaaggcaggagaaacaaaagacattcctataacatcaatc
tga

DBGET integrated database retrieval system