KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385653
Entry
100385653         CDS       T03264                                 

Gene name
APC
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04810  Regulation of actin cytoskeleton
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100385653 (APC)
   04390 Hippo signaling pathway
    100385653 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100385653 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100385653 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100385653 (APC)
   05206 MicroRNAs in cancer
    100385653 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100385653 (APC)
   05225 Hepatocellular carcinoma
    100385653 (APC)
   05226 Gastric cancer
    100385653 (APC)
   05217 Basal cell carcinoma
    100385653 (APC)
   05213 Endometrial cancer
    100385653 (APC)
   05224 Breast cancer
    100385653 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100385653 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    100385653 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100385653 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100385653 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100385653 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100385653 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100385653 (APC)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100385653 (APC)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100385653 (APC)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100385653 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u15 APC_rep APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 100385653
NCBI-ProteinID: XP_002744757
Ensembl: ENSCJAG00000016440
LinkDB
Position
2
AA seq 2842 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT
EAERSSQNKHETGSHEAERQNEGQGVTEINMATSGNGQGSTTRMDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRSKQRHKQSLYGDYVFDTNRHDDNRSENFNTGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQITTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCVTDERNALRRSSTAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQSERWARPKHIIEDEIKQSEQRQSRSQSTTYPVYTE
TTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
TNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYSTDIPSSQKQSFSFSKS
SSGQSTKTEHISSSSENTSTPSSNAKRQNQLHPSSAQNRSGQTQKAATCKVSSINQETIQ
TYCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQEADSANTLQIAEIKENNGTRSTEDPV
SEVPAVSQHTRTKSSRLQGSSLSSESTRHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET
PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP
PPPQTAQTKREVPKSKAPSAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFAMESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEVEKTVDSE
KDLLDDSDDDDIEILEECIISAMPTKSSHKAKKPAQTASKLPPPVARKPSQLPVYKLLPS
QNRLQPQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRAGAQ
SGEFEKRDTIPTEGRSTDEAQGGKNSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKP
FRVKKIMDQVQQASASSSATNKNQLDGKKKKPTSPVKPIPQNNEYRTRVRKNVDSKNNLN
AERALSDNKDSKKQNLKNNSKDLNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRND
SLSSLDFDDDDVDLSREKAELRKGKENKESEAKVTSHTELTSNQQSANKTQAIAKYPVNR
GQPKPILQKQSTFPQSSKDIPERGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENN
NKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQ
ECISSAMPKKKKPSRLKGDSEKHSPRNMGGILAEDLTLDLKDIQRPDSEHGLSPDSESFD
WKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFT
SNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQAN
MPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPHKTPASKSPSEGQAATTSPRGAKPSVKS
ELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPN
KLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKG
LNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESA
SFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQPGGWRKLPPNLSPTIEYNDG
RPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSES
SEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEISPTNSTSQTISSGATNGAES
KTLIYQMAPAVSKTEDIWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGNPNIKDSKDN
QAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTETKPGQNNPVPASETNESSIVERT
PFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNTKKRDSKTD
STDSSGTQSPKRHSGSYLVTSV
NT seq 8529 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacaactacaaggaagtattgaagatgaagctatg
gcttcttctggacagattgatttattagagcgtcttaaagagcttaacttagatagcagt
aatttccctggagtaaaactacggtcaaaaatgtcccttcgttcttatggaagccgggaa
ggatctgtatcaagccgttcaggagagtgcagtcctgttcctatgggttcatttccaaga
agagggtttgtaaatggaagcagagaaagtactggatatttagaagaacttgagaaagag
aggtcattgcttcttgctgatcttgacaaagaagaaaaggaaaaagactggtattatgct
caacttcagaatctcactaaaagaatagatagtcttcctttaactgaaaatttttcctta
cagacagatatgaccagaaggcaattagaatatgaagcgaggcaaatcagagttgcaatg
gaagagcaactaggcacttgccaggatatggaaaaacgagcacagagaagaatagccaga
attcagcaaatcgagaaagacatacttcgtataagacagcttttacagtcccaagcaaca
gaagcagagaggtcatctcagaacaagcatgaaaccggctcacatgaagctgagcggcag
aatgaaggtcaaggagtgacagaaatcaacatggcaacttctgggaatggtcagggttca
actacacgaatggaccacgaaacagccagtgttttgagttctagtagcacacactctgca
cctcgaaggctgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtctcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgttttgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagctctccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgcgcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtgtgtgttctaatgaaactttcgtttgatgaa
gagcatagacatgcaatgaatgaactagggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggcttactaatgaccactacagtattacactaagacgatat
gctggaatggctttgacaaacttgactttcggagatgtagccaacaaggctacgctatgc
tctatgaaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaagactta
cagcaggttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagtaaa
aagacattgcgggaagttggaagtgtgaaagcattgatggaatgtgctttggaagttaaa
aaggaatcaaccctcaaaagcgtattgagtgccttatggaatttgtcagcacattgcact
gagaataaagctgatatatgtgctgtagatggtgcacttgcatttttggttggcactctt
acttaccggagccagacaaacactttagccattattgaaagtggaggtgggatattacgg
aatgtgtccagcttgatagctacaaatgaggaccacaggcaaattctaagagagaacaac
tgtctacaaactttattacaacacttaaaatctcatagtttgacaatagtcagtaatgca
tgtggaactttgtggaatctctcagcaagaaatcctaaagaccaggaagcattatgggac
atgggggcagttagcatgctcaagaatctcattcattcaaagcacaaaatgattgctatg
ggaagtgctgcagctttaaggaatctcatggcaaataggcctgcaaagtataaggatgcc
aatattatgtctcctggctcaagcttgccgtctcttcatgtcaggaaacagaaagcccta
gaagcagaattggatgctcagcatttatcagaaacttttgacaatatagacaatttaagt
cccaaggcatctcatcgcagtaagcagagacacaagcaaagtctctacggtgattatgtt
tttgacaccaatcgacatgatgataataggtcagaaaattttaatactggcaacatgact
gttctttcaccatatttgaatactacagtgttacccagttcctcttcatcaagaggaagc
ttagatagttctcgttctgaaaaagatagaagtttggagagagaacgaggaattggccta
ggtaactaccatccagcaacagaaaatccaggaacctcttcaaagcgaggtttgcagatc
accaccactgcagcccagattgccaaagtcatggaagaggtgtcagccattcatacctct
caggaagacagaagttcggggtctaccactgaattacattgtgtgacagatgagagaaat
gcacttagaagaagttctactgcccatacacattcaaacacttacaatttcaccaagtca
gaaaattcaaacaggacatgttctatgccttatgccaaattagaatacaagagatcttcg
aatgatagtttaaatagtgtcagtagtagtgatggttatggtaaaagaggtcaaatgaaa
ccctcaattgaatcctattctgaagatgatgaaagtaagttttgcagttatggtcaatac
ccagctgacctcgcccataaaatacatagtgcaaatcatatggatgataatgatggagaa
ctagatacaccaataaattacagtcttaaatattcagatgagcagttgaactctggaagg
caaagtccttcacagagtgaaagatgggcaagacccaaacacataatagaagatgaaata
aaacaaagtgagcaaagacaatcaaggagtcaaagtacaacttatcctgtgtatactgag
accactgatgataaacacctcaagttccaaccgcattttggacagcaggaatgtgtttcc
ccgtacaggtcacggggagccaatggttcagaaacaaatcgagtaggttctaatcatgga
attaatcaaaatgtaagccagtctttgtgtcaagaagatgactatgaagatgataagcca
accaactatagtgaacgttactctgaagaagaacagcatgaagaagaagagagaccaaca
aattacagcataaaatataatgaagagaaacatcatgtggatcaacctattgattatagt
ttaaaatattctacagatattccttcatcacagaaacagtcattttcattctcaaagagt
tcatctggccaaagcactaaaactgaacacatctcttcaagcagtgagaatacatccaca
ccttcatctaatgccaaaaggcagaatcagcttcatccaagttctgcacagaacagaagt
ggtcagactcaaaaggctgccacttgcaaagtttcttctattaaccaagaaacaatacag
acttactgtgtagaagatactccaatatgtttttcaagatgtagttcattatcatctttg
tcatcagctgaagatgaaataggatgtgatcagacgacacaggaagcagattctgctaat
actctgcaaatagcagaaataaaagaaaataatggaactaggtcgactgaagatcctgtg
agcgaagttccggcagtgtcgcagcacactagaaccaaatccagcagactgcagggttct
agtttatcttcagaatcgaccagacacaaagctgttgaattttcttcaggagcaaaatcc
ccctccaaaagtggtgctcaaacacccaaaagtcctcctgaacactacgtgcaggagact
ccactcatgtttagcagatgtacttctgtcagttcacttgatagtttcgagagtcgttca
attgctagttccgttcagagtgaaccgtgcagtggaatggtaagtggcattataagtccc
agtgatcttccagatagccctggacaaaccatgccaccaagcagaagtaaaacccctcca
cctcctcctcaaacagctcagaccaagcgagaagtacctaaaagtaaagcacctagtgcc
gaaaagagagagagtggacctaagcaagctgcagtaaacgctgcagttcagagggtccag
gttcttccagatgctgatactttattacattttgccatggaaagtactccagatggattt
tcttgttcatctagcctgagtgctctgagcctcgatgagccatttatacagaaagacgtg
gaattaagaataatgcctccagttcaggaaaatgacaatgggaatgaaacagaatcagag
cagcctaaagaatcaaatgaaaaccaggagaaagaggtagaaaaaactgttgattctgaa
aaggacctattagatgattcagatgatgatgatattgaaatactagaagaatgtattatt
tctgccatgccaacaaagtcatcacataaagcaaaaaagccagcccagactgcctcaaaa
ttacctccacctgtagcaaggaaaccaagtcagctgcctgtatacaaacttctaccatca
caaaacaggttgcaaccccaaaagcatgttagttttacaccgggagatgatgtgccacgg
gtatattgtgtagaagggacacctataaacttttccacagctacatctttaagtgatcta
acaatagaatcccctccaaatgagttagctgctggagaaggagttagagcaggggcacag
tcaggtgaatttgaaaaacgagataccattcctacagaaggcagaagtacagatgaggct
caaggaggaaaaaactcatctgtaaccatacctgaattggatgacaataaagcagaagaa
ggtgatattcttgcagaatgcattaattctgctatgcccaaagggaaaagtcacaagcct
tttcgtgtgaaaaagataatggaccaggtccagcaagcatctgcgtcttcatctgcaacc
aacaaaaatcagttggatggtaagaaaaagaaacctacttcaccagtaaagcctatacca
caaaataatgaatataggacacgtgtaagaaaaaatgtagactcaaaaaataatttaaat
gctgagagagctctctcagacaacaaagattcaaagaaacagaacttgaaaaataattcc
aaggacttaaatgataagcttccaaataatgaagatagagtcagaggaagttttgctttt
gattcacctcatcattatacacctattgaaggaactccttactgtttttcacgaaatgat
tctttgagttccctagattttgatgatgatgatgttgacctttccagagaaaaggctgaa
ttaagaaaggggaaagaaaataaggaatcagaagctaaagttaccagccacacagaacta
acctccaaccaacaatcggctaataagacacaagctattgcaaagtatccagtaaatcga
ggtcagcctaaacccatactgcagaaacaatccacttttccccagtcatccaaagacata
ccagagagaggggcagcaaccgatgaaaaattgcagaattttgctattgaaaatactcca
gtttgcttttctcataattcctctctgagttctctcagtgacattgaccaagaaaacaac
aataaagaaaatgaacctatcaaagagactgagccccctgactcacagggagaaccaagt
aaacctcaagcatcaggctatgctcctaaatcgtttcatgttgaagatacccctgtttgt
ttctcaagaaacagttctctcagttctcttagtattgactctgaagatgacctgctgcag
gaatgtataagttccgcgatgccaaaaaagaaaaagccttcaagactcaagggtgatagt
gaaaaacatagccccagaaatatgggtggcatattagctgaagatctgacccttgatttg
aaagatatacagagaccagattcagaacatggtttatcccctgattcagaaagttttgat
tggaaagctattcaggaaggtgcaaattccatagtgagtagtttacatcaagctgctgct
gctgcgtgtttatctagacaagcttcatctgattcagattccatcctttccttgaaatca
ggaatctctctggggtcaccatttcatcttactcctgatcaagaagaaaaaccctttaca
agtaataaaggcccacgaattctaaaaccaggggagaaaagtaccttggaaactaaaaag
atagaatctgaaagtaaaggaatcaaaggaggaaaaaaagtttataaaagtttgattact
ggaaaggttcgatctaattcagaaatttcaggccaaatgaaacagcctcttcaagcaaac
atgccttcaatctctcgaggcaggacaatgattcatattccaggagttcgaaatagctct
tcaagtacaagtcctgtttctaaaaaaggccccccacataagaccccagcttccaaaagc
cctagtgaaggtcaggcggcaaccacttctcctagaggagccaagccatctgtgaaatca
gaattaagccctgttgccagacagacatcccaaataggtgggtcaagtaaagcaccttct
agatcaggatctagagattcgaccccttcaagacctgcccagcagccattaagtagacct
atacagtctcctgggcgaaactctatttcccctggtagaaatggaataagtcctcctaac
aaattatctcagcttccaaggacatcatcccctagtactgcttcaactaagtcctcaggt
tctggaaaaatgtcgtatacatctccaggcagacagatgagccaacagaaccttaccaaa
caaacaggtttatccaagaatgccagtagtattccaagaagtgagtctgcctccaaagga
ctaaatcagatgaataatggcaatggagccaataaaaaggtagaactttctagaatgtct
tcaactaaatcaagtggaagtgaatcggatagatcagaaagacctgttttagtacgccag
tcaactttcatcaaagaagctccaagcccaaccttacgaagaaaattggaggaatctgct
tcatttgaatctctttctccatcgtctagaccagcttctccaactaggtcccaggcacaa
actccagttttaagtccttcccttcctgatatgtctctatccacacattcatctgttcag
cctggtggttggcgaaaactcccacctaatctcagtcccactatagagtataatgatgga
agaccagcaaagcgccatgatattgcacggtctcattctgaaagtccttctagactgcca
atcaataggtcaggaacctggaaacgtgagcacagcaaacattcatcatcccttccccga
gtaagcacttggagaagaactggaagttcatcttcaattctttctgcctcatcagaatcc
agtgaaaaagcaaaaagtgaggatgaaaaacatgtgaactctatttcaggaaccaaacaa
agtaaagaaaaccaagtatccgcaaaaggaacatggagaaaaataaaagaaaatgaaatt
tctcccacaaatagtacttctcagaccatttcctcaggtgctacaaatggtgctgaatca
aagaccctaatttatcaaatggcacctgctgtttctaaaacagaggatatttgggtgaga
attgaggactgtcccattaacaaccctagatctggaagatctcccacaggtaatactccc
ccagtgattgacagtgtttcagaaaagggaaatccaaacattaaagattcaaaagataat
caggcaaaacaaaatgtgggtaatggcagtgttcccatgcgtaccgtgggtttggaaaat
cgcctgaactccttcattcaggtagatgcccctgaccaaaaaggaactgagacaaaacca
ggacaaaataatcctgtccctgcatcagagactaatgaaagttctatagtggaacgtacc
ccatttagttctagcagctcaagcaaacacagttcacctagtgggactgttgctgccaga
gtgactccttttaattacaacccaagccctaggaaaagcagcgcagatagcacttcagcc
cggccatctcagatcccaactccagtgaataacacgaagaagcgagattcaaaaactgac
agcacagattccagcggaacccaaagtcctaagcgccattctgggtcttaccttgtgaca
tctgtttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397972
Entry
100397972         CDS       T03264                                 

Gene name
APC2
Definition
(RefSeq) APC2, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04810  Regulation of actin cytoskeleton
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100397972 (APC2)
   04390 Hippo signaling pathway
    100397972 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100397972 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100397972 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397972 (APC2)
   05206 MicroRNAs in cancer
    100397972 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100397972 (APC2)
   05225 Hepatocellular carcinoma
    100397972 (APC2)
   05226 Gastric cancer
    100397972 (APC2)
   05217 Basal cell carcinoma
    100397972 (APC2)
   05213 Endometrial cancer
    100397972 (APC2)
   05224 Breast cancer
    100397972 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100397972 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    100397972 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100397972 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100397972 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100397972 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100397972 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100397972 (APC2)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100397972 (APC2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100397972 (APC2)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100397972 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Arm_APC_u3 Arm Suppressor_APC SAMP bZIP_1 ZapB Sec7_N DUF1241 Herpes_BLRF2
Other DBs
NCBI-GeneID: 100397972
NCBI-ProteinID: XP_017822750
Ensembl: ENSCJAG00000005645
LinkDB
Position
22
AA seq 1526 aa
MGLLGLLSLLHSAFFGDQTLQELKMTSSVASYEQLVRQVEALKAENSHLRQELRDNSSHL
SKLQTETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQLKALQMDIASLYNLKFQPPAL
GPEPAARTPEGSPVHGSGPSKDSLGELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYY
SQLQGLSKRLEELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRA
SRLEQIDKELLEAQDRVQQTEPQALLAVKSMPVDEDHETEVPTHPEDGTPQPGNSKVEVV
FWLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTGTEAGGRAGAPG
APGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQAREGGPD
GGGASGAPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRD
PLNLALRRYSGMTLTNVTFGDVANKATLCARRGCMEAIVAQLASDSEELHQVVSSILRNL
SWRADINSKKVLREAGSVAALVQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDG
ALGFLVSTLTYRCQSNSLAIIESGGGILRNVSSLIATREDYRQVLRDHSCLQTLLQHLTS
HSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLA
HRPAKHQAAATAVSPGSCVPSLYVRKQRALEAELDARHLAQALEHLEKQGPPAADAAAKK
PLPPLRHLDGLAQDYASDSGCFDDDDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQAL
ARTPPTRRGGMEAEKEANGEAAVAAKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSS
GDPGQEAPREGRAQSCSPCRGPEGGRRDAGNRGHPLLRLKAAHASLSNDSLNSGSASDGY
CPREHMQPCPLAALASRREDPRCGQPRPSRLDLDLPGSQGEAPAREAASADARVRTIKLS
PTYQHVPLLEGATRAGAEPLAGTGSRKHAWLPADHLSKVPEKLAAGPLSADSKRCKAGSA
XAPLSLSRCSSLSRCPPQRCISSALPRRRPTVSGLRRRKPRXTRLDERPADGSRERGEEA
AGSDRASDLDSVEWRAIQEGANSIVTWLHQAAAATREASSESDSILSFVSGLSVGSTLQP
PKHRKGRQAGGETANARRPEKRGTASAKTGGSSRSPAGPEKSRGTQKTTPGVPAVLRGRT
VIYVPSPAPRAQPKGTPGPRTTPRKVAPPCLAQPAAPAKVPSPGQQRSRSLHRPGKTSEL
ATLSQPPRSATPPARLAKTPSSSSSQTSPASQPLPRKRPQVTQAAGSLPGPGASPVPKTP
ARTLLAKQHKTQRSPVRIPFMQRPARRGPPALARAVPEPGPRGGAGAEVGPGTRGGRLGL
VRVASALSSGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASCPPGRLAHGRGRP
ALPAVLICSSRCFPFRHLRARGLGMP
NT seq 4581 nt   +upstreamnt  +downstreamnt
atggggctcctggggctcctgagcctgctgcactcggccttcttcggggaccagacgctg
caggagctgaagatgacgagctccgtggcgtcctacgagcagctggtgcggcaggtggag
gccttgaaggccgagaacagccacctgaggcaggagctccgggataactccagccacctg
tccaagctgcagacagagacgtcgggcatgaaggaggtgttgaagcatctgcaggggaag
ctggagcaggaggcccgagtgctggtgtcctcgggacagacggaggtgctagagcagctg
aaagccctgcagatggacatcgccagcctgtacaacctcaaattccagccgcctgccctg
ggcccggaacctgctgcccggacccccgagggcagcccggtacatggctccgggccctct
aaggacagccttggggagctgagccgggccaccatccggctgctggaggaactggaccgg
gaacggtgtttcctgctgaatgagattgagaaggaggagaaggagaagctctggtactac
tctcagctgcagggcctgtccaagcgcctggaagagctgccgcacgtggagacgcagttt
tcgatgcagatggacctgatacggcagcagctggagttcgaggcccagcacatccgctca
ctgatggaggagcgctttggcacctcggacgagatggtgcagcgggcgcagatccgcgcc
tcgcgcctggaacagattgacaaggagttgctggaggcacaggaccgagtgcagcagacg
gagccccaggccttgctggcggtgaagtcgatgccggtggacgaggaccacgagacagag
gtccccacacacccagaggatggcacccctcagccaggcaacagcaaggtggaggtggtc
ttctggctgttgtccatgttggcgacgcgtgaccaggaggatactgcgcgcacgctgctg
gccatgtccagctcgccggagagctgcgtggccatgcgccgctcgggctgcctgccgctg
ctgctgcagatcctccacggcaccggcactgaggccgggggtcgcgccggggctccaggg
gcgccgggggccaaggacgcgcgcatgcgtgccaacgcggctctgcacaacatcgtcttc
tcgcagccggaccagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctggagcag
atccgcgcctactgcgagacgtgctgggactggctgcaggcccgggagggcggacccgac
ggaggcggagccagtggcgccccggtccccatcgagccgcagatctgccaggccacctgt
gcggtgatgaagctgtcctttgatgaggaataccgccgtgccatgaacgagttaggtggg
ctgcaggccgtggcggagctgctgcaagttgactacgagatgcacaagatgacccgggac
ccgctgaacctggcgctgcgccgctactcgggcatgaccctcaccaacgtcaccttcggg
gacgtggccaacaaggccaccctgtgtgcacgccggggctgcatggaggccatcgtggcc
cagctggcctcagacagcgaggagctccaccaggtggtgtccagcatcctccgcaacctc
tcctggcgggccgacatcaacagcaagaaggtgctgagggaggcgggcagtgtggccgcc
ctggtgcagtgcgtcctgcgggccaccaaggagtccaccctgaagagcgtgctcagcgcc
ctgtggaacctgtctgcgcacagcacggagaacaaggcggccatctgccaggtggacggc
gccctgggcttcctggtgagcaccctgacctacaggtgccagagcaactcgctggccatc
atcgagagcggcggcggcatcctgcgcaacgtgtccagcctgatcgccacgcgggaggac
tacaggcaggtgctccgggatcacagctgtctgcagacgctgctgcagcacctgacctcg
cacagcctgaccatcgtgagcaacgcgtgcggcacgctctggaacctgtcagcccgcagc
gcgcgcgaccaggagctgctgtgggacctgggcgccgtgggcatgctgcggaacctggta
cactccaaacacaagatgatcgccatgggcagcgccgccgccctgcgcaacctgctggcc
cacaggcccgccaagcaccaggcggccgccaccgccgtgtccccgggcagctgcgtgccc
agcctgtacgtgcgcaagcagcgggcgctggaggccgagctggacgcgcggcacctggcg
caggcgctggagcacctggagaagcagggcccacccgccgccgacgccgctgctaagaag
ccgctgccacccctgcgacacctggacggcctggctcaagactacgcttccgactcaggg
tgctttgacgacgacgatgcgccgtcatccctagccgcggctgcggccactggggagccg
gccagccccgcagcactgtcactgttcctgggcagccccttcctgcaagggcaggcgctg
gcccgcaccccgcccacgcgccgcggtggcatggaggcggagaaggaggccaatggggag
gccgccgtggcggccaaggccaaggccaagctggcgcttgcagtggcgcgcatcgaccag
ttggtggaggacatctccgccctgcacacctcctccgacgacagcttcagcctcagctct
ggggaccccgggcaggaggcgccacgggagggccgtgcccagtcctgctcaccatgccgt
ggccccgagggcgggcggcgagacgcaggcaaccggggacacccactgctgcggctcaag
gcggcccacgccagcctctccaatgacagcctcaacagcggcagtgccagtgatgggtac
tgcccacgcgagcacatgcagccctgcccgctggccgcactagcttcgcgccgcgaggac
cccaggtgtgggcagcctcggcccagccggcttgaccttgacctgccaggcagccagggt
gaggcccccgccagggaggccgcatccgccgacgcccgtgtgcgcaccatcaagctgtcg
cccacctaccagcacgtgccgctgctcgagggtgccacgagggcgggtgcagagcccctc
gcggggactgggtcccgaaagcacgcctggctgccggcagaccatctgagcaaggttccc
gagaagctggcggcgggcccactgtccgcggacagtaagcgctgcaaagctggtagcgca
tgagcgccgctctcgctgtcccgatgcagctccctctctcgctgtcctccgcagcgctgc
atcagctcggccctgcccagacgccggcccaccgtgtccggcctgcggcgccgcaagccc
cgtngcacgcggctggatgaacggccggcagacggatcccgggagcgcggcgaggaggca
gcgggttcggaccgggcctcagacctggacagcgtggagtggcgagccatccaggagggc
gccaactccatcgtcacgtggctgcaccaggcggcggctgccacgcgcgaggcatcatct
gagtctgactccatcctgtccttcgtatctgggctgtcggtgggctccaccctacagccc
cccaagcacaggaagggacgacaggcgggaggcgaaaccgccaatgcccggcggccagag
aaacggggcacagcctcagccaagaccggagggagctcccgttcccctgcgggccctgag
aagtcacgtggcacacagaagaccacgcccggggtgcccgctgtgctccggggacgaacg
gtcatctacgtgcccagcccagcaccccgggcccagcccaaagggactcccggcccccgc
accacaccgcggaaggtggcgcccccttgcctggcacagcccgcggctccagccaaagtc
cccagccccggacagcagcggtcaaggagcctacaccggcccggcaagacctcggagctg
gcgacgctgagccaaccccctaggagcgccacaccacccgcccgcctcgccaagaccccc
tcctccagctcctctcagacctcgcccgcctcccagcccctgcccagaaagcgcccccaa
gttacccaggctgctgggtccctgcccggccccggggcctccccggtgcccaagacgccg
gcgcgcaccctcttggcgaagcagcacaagacacagaggtcgcccgtgcggatcccgttc
atgcagagaccagcccggcgggggccgccagcgctggctcgggcagtcccggagccgggc
cccaggggcggggcgggggccgaggtgggcccgggaacgcgcgggggccgcctgggcctc
gtgcgcgtggcctcggccctctccagcggcagcgagtcctccgaccgctcgggcttccgg
cgacaactgaccttcatcaaggagtcgcccggcttgcggcgccgccgctcggagctgtcc
tcggccgagtccgcggcctcatgccccccagggcgcctcgcccacgggcgcggccgaccc
gcgctgcccgcggtcctcatctgctcctcgcgctgcttcccatttcggcaccttcgtgca
agaggcctggggatgccgtaa

DBGET integrated database retrieval system