KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385835
Entry
100385835         CDS       T03264                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04621  NOD-like receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05212  Pancreatic cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100385835 (JAK1)
   04151 PI3K-Akt signaling pathway
    100385835 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100385835 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100385835 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100385835 (JAK1)
   04658 Th1 and Th2 cell differentiation
    100385835 (JAK1)
   04659 Th17 cell differentiation
    100385835 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100385835 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100385835 (JAK1)
   05203 Viral carcinogenesis
    100385835 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100385835 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100385835 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100385835 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100385835 (JAK1)
   05161 Hepatitis B
    100385835 (JAK1)
   05160 Hepatitis C
    100385835 (JAK1)
   05171 Coronavirus disease - COVID-19
    100385835 (JAK1)
   05164 Influenza A
    100385835 (JAK1)
   05162 Measles
    100385835 (JAK1)
   05168 Herpes simplex virus 1 infection
    100385835 (JAK1)
   05163 Human cytomegalovirus infection
    100385835 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100385835 (JAK1)
   05169 Epstein-Barr virus infection
    100385835 (JAK1)
   05165 Human papillomavirus infection
    100385835 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100385835 (JAK1)
   05140 Leishmaniasis
    100385835 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100385835 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100385835 (JAK1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100385835 (JAK1)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100385835 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 100385835
NCBI-ProteinID: XP_008999647
Ensembl: ENSCJAG00000016743
UniProt: U3BR01
LinkDB
Position
7
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNHTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLRISSENEMN
WFYSNDSGNVQYYEVMVTGNLGIQWRQKPNVVSVEKEKNKLKRKKLESKHKKDEEKNKVR
EEWSSFSYFPEITHIVIKESLVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVQGAQKQFKNFQIEVHKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGT
LMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSEFGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYHLMRKCWEFQPSNRTS
FQSLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatctgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggagctg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaatctctttgccttg
tatgatgagaacaccaagctctggtatgctccaaatcacaccatcactgtcgatgacaag
atgtccctccggctccactacaggatgaggttctatttcaccaattggcatggaaccaat
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aagaaggttccagatgcaacccctctccttgatgccagttcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcccattcgagaccccaagaccgagcag
gatgggcatgatattgagaacgagtgtctggggatggctgtcctggccatctcgcactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaacaagtccatcagacagaggaaccttctcacgaggatgcggatt
aataatgttttcaaggatttcctcaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tacggtgctgaaatatttgagacctccatgttacggatttcatcagaaaatgagatgaat
tggttttattcaaatgacagtggaaatgttcagtactatgaagtgatggtgactgggaat
cttggaatccagtggaggcagaaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaagaagctggaaagtaaacacaagaaagatgaggagaaaaacaaggtccgg
gaagagtggagcagtttctcttacttccctgaaatcactcacattgtgataaaggagtct
ctggtcagcatcaacaagcaggacaacaagaaaatggaactgaagctctcttcccatgag
gaggccttgtcctttgtgtccctggtagacggctacttccggctcacagcagacgcccat
cattacctctgcactgatgtggcccccccgttgattgtccacaacatacaaaatggctgt
cacggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagtgaggag
gggatgtatgtgctgagatggagctgcacggactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgaggtgcagggtgcccagaagcagttcaagaactttcagatcgag
gtgcacaagggccgctacagcctgcacggttcggaccgcagcttccccagcttgggcgac
ctcatgagccacctcaagaaacagatcctgcgcacggataatatcagcttcatgctgaaa
cgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaagcc
caggagtggcagcccgtctaccccatgagccagctgagttttgatcggatcctcaagaag
gatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctactctgggacc
ctgatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatcctc
aaagttttagaccccagccacagggatatttccctggccttcttcgaagcagccagcatg
atgagacaggtctctcacaaacacatcgtgtacctctatggcgtctgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggaaggggggcctctggatctcttcatgcaccgg
aaaagcgatgtccttaccacaccatggaaattcaaagtggccaaacagctggccagtgcc
ctcagttacttggaggataaagacttggttcatggaaatgtgtgcactaaaaacctcctc
ctggcccgtgagggcattgacagcgagtttggcccattcatcaagctcagtgaccctggc
atccccatcacggtgctgtctagacaagagtgcattgaacgaatcccatggattgctcct
gagtgtgtggaggactccaagaatctgagtgtggctgctgacaagtggagctttggaacc
acgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacactgattgag
aaagagagattctatgaaagccggtgcaggccggtgacaccgtcatgtaaggagctggct
gacctcatgacccgctgcatgaactacgaccccaatcagaggcccttctttcgagccatc
atgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaaacca
acaaccgaagtggaccccacacattttgaaaagcgcttcctaaagaggatccgtgacttg
ggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaataca
ggggagcaggtggctgtcaaatctctgaagcctgagagtggaggtaaccacatagctgat
ctgaaaaaggaaatcgaaatcttaaggaacctctatcatgagaacattgtgaagtacaaa
ggaatctgcacggaagacggtggaaatggtattaagctcatcatggaatttctgccttcg
ggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcagcta
aaatatgctgttcagatttgtaaggggatggactatttgggttctcggcaatatgttcac
cgggacttagcagcgagaaatgtccttgttgagagtgaacaccaagtgaaaattggagac
tttggtttaaccaaagcaattgaaaccgataaggagtattacacagtcaaggacgaccgg
gacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatattgcc
tctgacgtctggtcttttggagttactctgcatgagctgctgacttactgtgattcagat
tccagtcccatggccttgttcctgaaaatgataggcccaacccatggccagatgacagtc
acaagacttgtgaatacattaaaagaaggaaaacgcttgccgtgtccacctaactgtcca
gatgaggtttatcatcttatgaggaaatgctgggaattccaaccatccaatcggacaagc
tttcagagccttattgaaggatttgaagcacttttaaaataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397491
Entry
100397491         CDS       T03264                                 

Gene name
JAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04062  Chemokine signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04630  JAK-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc05161  Hepatitis B
cjc05162  Measles
cjc05166  Human T-cell leukemia virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05223  Non-small cell lung cancer
cjc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100397491 (JAK3)
   04151 PI3K-Akt signaling pathway
    100397491 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100397491 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100397491 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100397491 (JAK3)
   04659 Th17 cell differentiation
    100397491 (JAK3)
   04062 Chemokine signaling pathway
    100397491 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397491 (JAK3)
   05203 Viral carcinogenesis
    100397491 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100397491 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    100397491 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100397491 (JAK3)
   05161 Hepatitis B
    100397491 (JAK3)
   05162 Measles
    100397491 (JAK3)
   05169 Epstein-Barr virus infection
    100397491 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100397491 (JAK3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100397491 (JAK3)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100397491 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F1 FERM_F2 Jak1_Phl Kdo APH pKID
Other DBs
NCBI-GeneID: 100397491
NCBI-ProteinID: XP_017822788
LinkDB
Position
22
AA seq 1026 aa
MTVAQETKGPTQEGAEWDFPLAASWLCPPFERPGSLPARQAALMAPPNEETPLIPQRSCS
LLSTEAGALQVLLPARGPGPPQRLSFSYGDHLAEDLCVQAAKASGILPVYHSLFALATED
LSCWFPPSHIFSVEDATTHVLCYRIRFYFPNWCGLEKCHRFGLRKDLASAVLDLPVLEHL
FAQHRSDLVSGRLAVGLSLKEQGECLSLAVLDLARMSREQAQRPGELLKTVREAEFPGLP
EALSXVALVDGYFRLITDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSLP
GSYVLRRSPQDFESFLLTVCVQTPLGPDYKGCLIRRSPTGSFFLVGLSQPYSSVRELLAT
CWDGGLHVDGVPVTLTSCCIPRPKEKSNLIVVRRGHSPPTSSLVQPQSQCQLSQMTFHKI
PADSLEWHENLGHGSFTKIYRGCRHEAVDGEARKTEVLLKVMDAKHRNCMESFLEAASLM
SQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALN
YLEDKGLPHGNVSARKVLLARDGGDGSPPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECL
QGAQTLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLI
QQCMDYEPVRRPSFRAIIRDLNSLISADYELLSDLTPGALAPRDGLWNGTQLYACQDPTI
FEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILK
ALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRAHLDASRLLLYASQICKG
MEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAXLLPLDKXXXXVPLPQGKPPESLSD
NIFSRQSDVXSFGVVLYELFRYCDKRCSPSAEFLRLMACERDVPALCRLLELLEEGQRLP
APPACPAEVHELMKLCWATSPQDRPSFSALGPQLDMLCVSRSRRCETPTFPAHPFSVLQT
SGLGLC
NT seq 3081 nt   +upstreamnt  +downstreamnt
atgacagtggctcaggaaaccaaggggcccacacaggaaggagccgagtgggactttcct
ctcgctgcctcctggctctgccctccctttgaacgcccaggatccctgcctgctaggcaa
gctgccctcatggcacctccaaacgaagagacgcccctgatccctcagcgttcctgcagc
ctcttgtccacggaagctggtgccctacaagtgctgctgcctgcccggggcccagggccc
ccccagcgcctatctttctcctatggggaccacttggctgaggacctgtgtgtgcaggct
gccaaggccagcggcatcctgcctgtgtaccactccctctttgctctggccaccgaggac
ctgtcctgctggtttcccccaagtcacatcttctccgtggaagatgccaccacccatgtc
ctctgctacaggattcgcttttacttccccaattggtgtgggctggagaagtgccaccgc
tttgggctgcgaaaggatttggccagcgctgtccttgacctgccagtcctggagcacctc
tttgcccagcaccgcagtgacctggtgagtggacgcctcgctgtgggcctcagcctcaag
gagcagggtgagtgtctcagcttggctgtgctggacctggcccggatgtcaagagagcag
gcccagcggccaggagaactgttgaagactgtcagggaggccgagttcccggggctgccc
gaggcgctgtccnttgtggcgctcgtggacggctacttccggctgatcacggactcccag
cacttcttctgcaaggaggtggcaccgccgaggctgctggaggaggtggccgagcagtgc
cacggccccatcactctggactttgccatcaacaagcttaagactgggggctcacttcct
ggctcctatgttctccgccgcagcccccaggactttgagagcttcctccttactgtttgt
gttcagacccccctcggtcctgattacaagggctgcctcatccggcgcagccccacagga
tccttttttctggttggcctcagccaaccctacagcagtgttcgagagctcctggcaacc
tgctgggatggagggctgcacgtagatggggtcccagtgaccctcacctcctgctgtatc
cccagacccaaagaaaagtccaacctgattgtggtccggagaggtcacagcccacccacg
tcctccctggttcagccccaatcccaatgccagctgagtcagatgacatttcacaagatc
cctgcggacagcctggagtggcatgagaacctgggccacgggtccttcaccaagatttac
cggggctgtcgccacgaggcagtggatggggaggcccgaaagacagaggtgctgctgaag
gtgatggacgccaaacacaggaactgcatggagtcattcctggaagcagcgagcttgatg
agtcaagtgtcataccggcatctcgtgttactgcacggcgtgtgcatggctggagacagc
accatggtgcaggaatttgtacacctgggggcaatagacatgtatctgcgcaagcgtggc
cacctggtgccagccagctggaagctacaggtggtcaaacagctggcctatgccctcaac
tatctggaggacaaaggcctcccccacggcaatgtctctgcccgaaaggtgctcctggct
cgggacgggggtgatgggagcccgcccttcatcaagctgagtgaccctggggtcagcccc
acggtgctaagcctggagatgctcacggacaggattccctgggtggcccccgagtgcctc
caaggggcccagacacttagcctggaagctgacaagtggggcttcggcgccaccgtctgg
gaggtgtttagtggcgtcaccatgcccatcagtgccctggatcccgctaagaaactccag
ttttatgaggaccggcagcagctgccggcccccaagtggacagagctggctctgctcatt
cagcagtgcatggactacgagccagtccggagaccctcctttcgagccatcatccgtgac
ctcaacagcctcatctctgcagattatgagctcctctcagacctcacacctggtgccctg
gcacctcgtgatgggctgtggaatggtacccagctctatgcctgccaagaccccacgatc
tttgaggagagacaccttaagtacatctcacagctgggcaagggcaactttggcagcgtg
gagctgtgccgctatgacccgctaggcgacaacacaggtgccctggtggccgtgaaacag
ctgcagcacagcgggccagaccagcagagggacttccagcgggagatccagatcctcaaa
gcactgcacagtgacttcattgtcaagtatcgtggtgtcagctacggcccgggccgccag
agcctgcggctggtcatggagtacctgcccagcggctgcctgcgcgacttcctgcagcgg
catcgcgcgcatctcgatgccagccggcttctcctctacgcctcgcagatctgcaagggc
atggagtacctgggctcccgccgctgcgtgcaccgcgacctggcagcccggaacatcctg
gtggagagcgaggcacacgtcaagatcgctgacttcggtctagcctagctgcttccgctt
gacaaannnnnnnnnnctgtccccctcccccaaggtaagccccccgagtccctctcggac
aacatattctctcgccaatcagacgtctgaagcttcggggttgtcctgtacgagctcttc
agatactgcgacaaaagatgcagcccctcggcggagttcctgcggttgatggcctgtgag
cgggatgtccccgccctctgccgcctcctggaactgctggaggagggccagaggctgcca
gcacctcctgcctgccctgctgaggttcacgagctcatgaagctgtgctgggccactagc
ccacaggaccggccgtcattcagcgccctgggcccccagctggacatgctgtgtgtaagt
cgaagccggaggtgtgagactcccaccttccctgctcacccattctctgtcctgcagacc
tctggattaggtctctgttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405583
Entry
100405583         CDS       T03264                                 

Gene name
TYK2
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04621  NOD-like receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc05145  Toxoplasmosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100405583 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100405583 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100405583 (TYK2)
   04658 Th1 and Th2 cell differentiation
    100405583 (TYK2)
   04659 Th17 cell differentiation
    100405583 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100405583 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100405583 (TYK2)
   05160 Hepatitis C
    100405583 (TYK2)
   05171 Coronavirus disease - COVID-19
    100405583 (TYK2)
   05164 Influenza A
    100405583 (TYK2)
   05162 Measles
    100405583 (TYK2)
   05168 Herpes simplex virus 1 infection
    100405583 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100405583 (TYK2)
   05169 Epstein-Barr virus infection
    100405583 (TYK2)
   05165 Human papillomavirus infection
    100405583 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100405583 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100405583 (TYK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100405583 (TYK2)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100405583 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 100405583
NCBI-ProteinID: XP_008985492
Ensembl: ENSCJAG00000006781
UniProt: U3F2R3
LinkDB
Position
22
AA seq 1187 aa
MPLRHRGTAKGGKPVGDGAQPVATMGGLKVLLHWAGPGGGDPWVIFSKSSLTAEEVCIHI
AHKLGITPPCFNLFALFDAQAQVWLPPNHILEIPRDAGLMLYFRMRFYFRNWHGMNPQEP
AVYRCGPPGAEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFK
NESLGMAFLHLCHLALHHGVPLEEVAKKTSFKDCIPHSFRRQIRQHNALTRLRLRNVFRR
FLRDFQPGCLSQQMVMVKYLATLERLAPRFGTEHMPVCHLRLLDQAEGEPCYIRDSGEAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVQEEVSKEEGSIRGSGSNLQASLSGKKAKAHK
AIAQPADKPREPPRVYFCDFRDITHVVLKERRVSIHRQDNKCLELSLPSRAMALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIQDGIHGPLLEPFVQAKLRTEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGTQSLQLRKFPIEQQAGAFILEGWGRSFSSVRELGAALRGCSLKV
GDDCFSLRRCCLPQPGETSNLIIMRGALASTRPLNLSQLSFHRVNQKEITQLSHLGQGTR
TNVYEGRLRVEGSGGPEEGKMDDEFPPGPSRDCGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHVHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGCVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLEEGTSPFIKLSDPGVGLGALSREERVERIPWMA
PECLPGGPNSLGTATDKWGFGATLLEICSDGEAPLQSRSPSEKERFYQRQHRLPQPSCPE
LATLTGQCLTYEPTQRPSFRTILRDLTRLQPYNLADVLTVNLDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIV
KYKGCSEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCASSQSPPTKFLELIGITQGQVTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWEMEASFRPTFQNLIPILKTVHEKYQGQAPSVFSVC
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgcctctgcgccatcggggaacagccaagggcggcaagcctgttggggatggagcccag
cccgtggctaccatgggaggcctgaaggtgcttctgcactgggctggtccaggcggcggg
gacccctgggtcatcttcagcaagtcatcgctgacagctgaggaagtctgcattcacatc
gcgcataaactcggtatcactcctccctgtttcaatctcttcgccctctttgatgcccag
gcccaagtctggttgcccccaaaccacatcctagagatccccagagacgcaggcctgatg
ctgtatttccgcatgaggttttatttccggaattggcatggcatgaatcctcaggagcca
gctgtgtaccgctgtgggcccccaggagctgaggcatcctcagatcagacagcacaaggg
atgcaactcctggacccagcctcatttgaatacctctttgagcagggcaagcatgagttt
gtgaatgatgtggcatcactgtgggagctgtcgagcgaggaggagatccaccactttaag
aatgagagcctgggcatggcctttctgcacctctgtcacctcgccctccaccatggcgtc
cccctggaggaggtggccaagaagaccagcttcaaggactgcatcccgcactccttccgt
cggcagatccggcagcacaacgccctgacccggctacgccttcggaacgtcttccgcagg
ttcctgcgggacttccagccaggctgcctctcccagcaaatggtcatggtcaaatacctg
gccacactcgagcggctggcaccccgctttggcacagagcatatgcccgtgtgccacctg
aggctgctggaccaggctgagggggagccctgctacatacgggacagtggggaggcccct
acagaccctggccctgagtctgctgctgggccccccacccacgaggtgctggtgacaggc
actggtggcatccagtggtggccagtacaggaggaggtgagcaaggaggagggttctatc
aggggcagcggcagcaatctccaagccagcctgtctgggaagaaagccaaggctcacaag
gcaatcgcccagccggcggacaagccgagggagccgcctcgggtctacttctgtgacttc
cgggacatcacccatgtggtgctgaaagagcgccgtgtcagcatccaccggcaggacaac
aagtgcctggagctgagcctgccttctcgggctatggcgctgtccttcgtgtcactggtg
gacggctatttccgcctgacagccgactccagccactacctgtgccacgaggtggctccc
ccacggctggtgatgagcatccaggacgggatccatggacccctgctggagccatttgtg
caggccaagctgcggaccgaggatggcctgtacctcattcactggagcaccagccacccc
tatcgcctgatcctcacggtggcccagcgtagccaggcaccagatggcacgcagagcttg
cagctccggaagttccccattgagcagcaggctggggccttcatactggagggctggggc
cggtccttctccagtgttcgggaacttggggctgctttgcggggctgctcactgaaagta
ggggatgactgcttctctctgcgtcgctgttgcctgccccaaccaggagaaacctccaac
ctcatcatcatgcggggggctctggccagcaccaggccactcaacctcagccagctcagc
ttccaccgggtcaaccagaaggagatcacccagctgtcccacttgggtcagggtacaagg
accaatgtgtatgagggccgcctacgagtggagggcagtgggggccctgaggagggcaag
atggacgacgagttcccccccgggcccagcagggactgtgggcaggagctgcgagtggtc
cttaaagtgctggatcctagtcaccatgacattgccctggccttctatgagacagccagc
ctcatgagccaggtctcccatgtgcacctggccttcgtgcatggcgtctgtgtgcgcggc
cctgaaaatatcatggtgacagagtacgtggagcacgggcccctggacgtgtggctgcgg
agggagcggggctgtgtgcccatggcttggaagatggtggtggcccagcagctggccagc
gccctcagctacctggagaacaagaacctggttcacggtaatgtgtgtggccggaacatc
ctgctggcacgtctggggctggaggagggcaccagccccttcatcaagctgagtgatccc
ggcgtgggcctgggcgccctctccagggaggagcgcgtggaacggatcccctggatggcc
cctgagtgcttgccaggcgggcccaatagcctaggcactgccacggacaagtggggcttt
ggtgccaccctcctcgagatctgctctgatggagaggccccccttcagagtcgcagcccc
tccgagaaagagcgtttctaccagaggcagcaccggctgccccagccctcctgcccagag
ctggccacactcactggccagtgtctgacctatgagccaacccagaggccatcattccgc
actatcctgcgtgacctcacccggctgcaaccctacaatcttgctgatgtcttgactgtg
aacctggactcacctgcgtcagaccctactgttttccacaagcgctatttgaaaaagatc
cgagatctgggcgagggccacttcggtaaggtcagcttgtattgctacgatccgaccaac
gacggcactggcgagatggtggcggtgaaagccctcaaggcagactgcggcccccagcac
cgctcaggctggaagcaggagattgatattctgcgcacgctctaccacgagcacatcgtc
aagtacaagggctgcagcgaggaccaaggcgagaagtcggtgcaactggtcatggagtac
gtgccactgggcagcctccgagactacctgccccggcacagcgtcgggctggcccagctg
ctgctcttcgcccagcagatctgcgagggcatggcctatctgcacgcgcagcactacatc
caccgagacctagccgcgcgcaacgtgctgctggacaacgacaggctggtcaagatcggg
gactttggcctagccaaggccgtgcccgaaggccacgagtactaccgtgtgcgcgaggat
ggggacagccccgtgttctggtatgccccagaatgcctgaaggagtataaattctactat
gcgtccgatgtctggtccttcggggtgaccctgtatgagctgctgacgcactgtgcctcc
agccagagcccccccacgaaattccttgagctcataggcatcacccagggtcaggtgaca
gtactgagactcactgagttgctggaacgaggggagaggctgccacggcccgacaaatgt
ccctgtgaggtctatcacctcatgaagaactgctgggagatggaggcatccttccgccca
accttccagaacctcatacccatcctgaagacagtccatgagaagtaccaaggccaggcc
ccttcggtgttcagtgtgtgctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413251
Entry
100413251         CDS       T03264                                 

Gene name
JAK2
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04062  Chemokine signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04630  JAK-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04725  Cholinergic synapse
cjc04917  Prolactin signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04935  Growth hormone synthesis, secretion and action
cjc05140  Leishmaniasis
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100413251 (JAK2)
   04151 PI3K-Akt signaling pathway
    100413251 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100413251 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100413251 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100413251 (JAK2)
   04659 Th17 cell differentiation
    100413251 (JAK2)
   04062 Chemokine signaling pathway
    100413251 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100413251 (JAK2)
   04917 Prolactin signaling pathway
    100413251 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    100413251 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    100413251 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100413251 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100413251 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100413251 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100413251 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100413251 (JAK2)
   05164 Influenza A
    100413251 (JAK2)
   05168 Herpes simplex virus 1 infection
    100413251 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100413251 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100413251 (JAK2)
   05140 Leishmaniasis
    100413251 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100413251 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100413251 (JAK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100413251 (JAK2)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100413251 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like
Other DBs
NCBI-GeneID: 100413251
NCBI-ProteinID: XP_002742952
Ensembl: ENSCJAG00000011228
LinkDB
Position
1
AA seq 1130 aa
MACLTVTEMEGTSTSSINQNGDISGNVNSMKQIDPVLQVYLYHSLGKAEADYLTFPSGEY
VAEEICIAASKACGITPLYHNMFALMSETERIWYPPNHVFHVDESTRDNVLYRIRFYFPH
WYCSGNNRTYRHGISRGAEAPLLDDCVMSYLFSQWRHDFVHGWIKVPVTHETQEECLGMA
VLDMMRIAKEKDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQ
CKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSRGK
HKESETLTAQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLREA
LSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQTGL
YVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQ
METVRSDNIIFQFTKCCPPKPKDKSNLLVFRMNGVSDVPISPTLQRHNNVNQMVFHKIRN
EDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMS
QLSHKHLVLNYGICVCGEENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMH
FLEEKTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPE
CIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELAN
LINNCMDYEPDFRPSFRAVIRDLNSLFTPDYELLTENDMLPNTRTGLSGFSVAFEDRDPT
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEIL
KSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICK
GMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYA
PESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELL
KNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAE
NT seq 3393 nt   +upstreamnt  +downstreamnt
atggcttgccttacagtgacagaaatggagggaacatccacgtcttctataaatcagaat
ggtgatatttctggaaatgtcaattctatgaagcaaatagatccggttcttcaggtgtat
ctttaccattcccttgggaaagctgaggcagattatctcacatttccatctggggaatat
gttgcagaagaaatctgtattgctgcttctaaagcttgtggcatcacacctttgtatcat
aatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccatgtcttc
catgtagatgaatcaaccagggataatgtactctacagaataagattttactttcctcat
tggtattgcagcggcaacaacagaacctatcggcatggaatatctcgaggtgctgaagct
cctcttctcgatgactgtgtcatgtcttaccttttttctcagtggcggcatgattttgtg
catggatggataaaagtacctgtgactcatgaaactcaggaagaatgtcttgggatggca
gtgttagatatgatgagaatagctaaagaaaaggatcagactccactggccatctataat
tctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagactatcac
attttgacaaggaagcgaataaggtacagatttcgcagatttattcagcagttcagccaa
tgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaactctgcag
tctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttcaggtgag
gagatttttgcaaccattataataactggaaacggtggaattcagtggtcaagagggaaa
cataaagaaagtgagacactgacagcacaggatttacagttgtattgtgattttcctaat
attattgatgtcagtattaagcaagcaaaccaagagggttcaaatgaaagcagagttgtg
actatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagggaagct
ttgtcttttgtgtcattaattgatggatattatagattaacggcagatgcacatcattac
ctctgtaaagaagtagcacctccaacggtgcttgaaaatatacaaagcaactgtcatggc
ccaatttcaatggactttgccatcagtaaactgaagaaagcaggcaatcagactggactg
tatgtacttcgatgcagtcctaaggacttcaataaatattttctgacttttgctgtcgag
cgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaagagtac
aacctcagtgggacaaagaagaacttcagtagtcttaaagatcttttgaattgttaccag
atggaaactgttcgctcagacaatataattttccagtttactaaatgctgtcccccaaag
ccaaaagataaatcaaaccttctagtcttcagaatgaatggtgtttctgatgtcccaatc
tcaccaacattacagaggcataataacgtgaaccaaatggtgtttcacaaaattagaaat
gaagatttgatatttaatgaaagccttggccaaggcacttttacaaagatttttaaaggc
atacgaagagaagtaggagattatggccaactgcatgaaacagaagttcttttaaaagtt
ctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatgatgagc
cagctttctcacaagcatttggttttaaattatggaatatgtgtctgcggagaggagaat
attctggttcaggagtttgtaaaatttggatcactagatacatacctgaaaaagaataaa
aattgtataaatatattatggaaacttgaagttgctaaacagttggcatgggccatgcat
tttctagaagaaaagacccttattcatgggaatgtgtgcgccaaaaatattctacttatc
agagaagaagacaggaagacaggaaatcctcctttcatcaaactcagtgaccctggcatt
agtattacagttttgccaaaggacattcttcaggagagaataccatgggtaccacctgaa
tgcattgaaaatcctaaaaatttaaatttggcaacagacaaatggagttttggtaccact
ttgtgggaaatctgcagtggaggagataaacccttaagtgctctggattctcaaagaaag
ctgcaattttatgaagataggcaccagcttcctgcaccaaagtgggcagaattagcaaac
cttataaataattgtatggattatgaaccagatttcaggccttccttcagagccgtcata
cgagatcttaacagtttgtttacaccagattatgaactattaacagaaaatgacatgtta
ccaaatacgaggacaggtctttcagggttttctgttgcttttgaagacagggatcctaca
cagtttgaagagagacatttgaaatttctacagcaacttggcaagggtaattttgggagt
gtggagatgtgccgatatgaccctctacaggacaacactggggaggtggtggctgtaaaa
aagcttcagcatagtactgaagagcacctgagagactttgaaagggaaattgaaatcttg
aaatcactgcagcatgacaacattgtaaagtacaagggagtgtgctacagtgctggtcgg
cgaaatctaaaattaattatggaatatttaccatatggaagtttacgagactatcttcaa
aaacataaagaacggatagatcacaaaaaacttctgcagtacacatctcagatctgcaag
ggtatggagtatcttggtacaaaaaggtatatccacagggatctggcgacaagaaatata
ttggtagagaatgagaacagagttaaaattggagattttgggttaaccaaagtcttgcca
caagacaaagaatactataaagtaaaagaacctggtgaaagccccatattctggtatgct
ccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagctttggagta
gttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaatttatg
cgtatgattggcaatgacaaacaaggacagatgatcgtgttccatttgatagaactgttg
aagaataatggaagattaccaagaccagatggatgcccagatgagatttatatgatcatg
acagaatgctggaacaataatgtaaatcaacgcccctcctttagggatctagctcttcga
gtggatcaaataagggataacatggctgaataa

DBGET integrated database retrieval system