KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385951Help
Entry
100385951         CDS       T03264                                 

Gene name
CXCR1
Definition
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100385951 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100385951 (CXCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100385951 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100385951 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100385951 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100385951 (CXCR1)
   04050 Cytokine receptors [BR:cjc04050]
    100385951 (CXCR1)
   04090 CD molecules [BR:cjc04090]
    100385951 (CXCR1)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100385951 (CXCR1)
Cytokine receptors [BR:cjc04050]
 Chemokine receptors
  CXC Chemokine
   100385951 (CXCR1)
CD molecules [BR:cjc04090]
 Proteins
  100385951 (CXCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 100385951
NCBI-ProteinID: XP_008997716
Ensembl: ENSCJAG00000010738
LinkDB All DBs
Position
6
AA seq 358 aa AA seqDB search
MSETEGNMWNITDPSMWLDDYLLNFTGEPPLEGDYSPCVVETETLNKYVVIITYALVFLL
SLLGNSLVMLVILYSRVSRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTPLCKV
VSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLSCWGLSLILSLPFF
LFREAYRPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLLVMLFCYGFTLCTLFKA
HMGQKQRAMRVIFAVVLIFLLCWLPYHLVLLTDTLMRTQMIKETCQRRNDIDRALDATEI
LGFFHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHHVTSYTSSSVNVSSNL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaactgaagggaacatgtggaatattacagacccatcgatgtggcttgatgac
taccttttaaatttcactggcgagccacctctagaaggagattacagcccctgtgtggta
gagactgagacactcaacaagtatgttgtcatcatcacctatgccctagtgttcctgctg
agcctgctgggaaattccttggtgatgctggtcatcttatacagtagggtcagccgctct
gtcaccgatgtctacctgctgaacctggccttagccgacctgctctttgccctgaccttg
cccatctgggctgcctccaaggtgaatggctggatttttggcacacccctgtgcaaggtg
gtctcactcttgaaggaagtcaacttctacagtggcatcttgctactggcctgcatcagc
gtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgtcacttg
gtcaagtttgtttgtctgagctgttggggactgtctctgattctgtccctgcctttcttc
cttttccgcgaagcctatcgtccaaacaattccagtccagtttgctatgaggtcctggga
aatgacacagcaaaatggcggatggtgctgcggatcctgccccacaccttcggcttcatt
gtgccgctgctggtcatgctgttctgctacggattcaccctgtgcacgctgtttaaggcc
cacatggggcagaagcagcgggccatgcgtgtcatctttgctgtggtcctcatcttcctg
ctctgctggctgccctaccacctggtcctgctcacagacaccctcatgaggacccagatg
atcaaggagacctgtcagcgccgcaacgacatcgaccgggccctggatgccactgagatt
ctgggattcttccacagctgcctcaaccccatcatctacgccttcatcggccaaaatttt
cgtcatggattcctcaagatcctggccatgcatggccttgtcagcaaggagttcttggca
cgtcatcacgttacctcttacacttcttcctctgtcaatgtctcttccaacctctaa

DBGET integrated database retrieval system