KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386059Help
Entry
100386059         CDS       T03264                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04371  Apelin signaling pathway
cjc05034  Alcoholism
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100386059 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100386059 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    100386059 (HDAC4)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100386059 (HDAC4)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100386059 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 100386059
NCBI-ProteinID: XP_017829348
Ensembl: ENSCJAG00000009423
LinkDB All DBs
Position
6
AA seq 1083 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCLSSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGNVSAENGISPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGAAGQQDAERLALPTLQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGKEAHPQGGVQVKQEPIESDDEEAEPPQEVEPGQRQPSEQELLFRQQALLLEQQR
IHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPVSVQEPPAKPRFTTGLVYDTL
MLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTL
LYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVEL
VFKVATGELKNGFAVVRPLGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDV
HHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPP
MGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLM
GLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVM
EIHSKYWRCLQRAASTAGRSLIEAQTCENDEAETVTAMASLSVGVKPAEKRPDEEPMEEE
PPL
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggacgtggccacggcgctgcctctg
caagtggcaccctcggcagtgcccatggacctgcgcctggaccaccagttctctctgcct
gttgcggagcctgctctgcgggagcagcagctgcagcaggagctcctggctctcaagcag
aagcagcagatccagaggcagatcctcattgccgagttccagaggcagcatgagcagctc
tcccgccagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggagcaccagcggaagctggagaggcaccgccaggag
caggagctagagaagcagcaccgggaacagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagctacaagagtttgtcctc
aataaaaagaaggcactggcgcaccggaacctgaaccactgcctttccagcgaccctcgc
tactggtacgggaaaacacagcacagttccctcgatcagagttctccaccccagagcgga
gtgtcggcctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgcccta
aaaaagcgtccgttggatgtcacagactctgcctgcagcagcgcccccggctccgggccc
agctcacccaacaacagctccggcaacgtcagcgccgagaacgggatctcacctgccgtc
cccagcatcccggcggagacgagtttggcgcaccgacttgtggcgcgagagggctcagcc
gctccacttcccctgtacacgtcgccctccctgcccaacatcacgctgggcctgcctgcc
accggcccttctgctggcgcggcaggccagcaggatgctgagagactcgccctccccacc
ctccagcagaggctctcccttttcccgggcacccacctcactccctacctgagcacctcg
cccttggagcgggatggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagcccccggcacaagcgccccttgtcacaggcctgggagctctgcccctccacgca
cagtccctggttggtgcggaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccactggggcggacccagtcagccccgctgccccagaacgcccaggccctgcagcacctg
gtcatccaacagcagcatcagcagtttctggagaaacataagcagcagttccagcagcag
caactgcacatgaacaagatcatccccaagccaagcgagccagcccggcagccggagagc
caccccgaggagacggaggaggaactccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggggaaggaggcgcacccacagggcggtgtgcaggtgaagcaggag
cccattgagagcgacgatgaagaggcggagcccccgcaggaggtggagccaggccagcgc
cagcccagtgagcaggagctactcttcagacagcaagctctcctgctggagcagcaacgg
atccaccagctgaggaactaccaggcgtccatggaggctgccggcatccccgtgtccttc
ggcagccaccggcctctgtcccgggcacagtcctcaccggcatccgccaccttccccgtg
tctgtccaggagccccctgccaaaccgaggttcacgacaggccttgtgtacgacacgctg
atgctgaagcaccagtgcacctgcgggagcagcagcagccaccctgagcacgccgggagg
atccagagcatctggtcccgcctacaggagaccggcctccgaggcaaatgcgagtgcatc
cgcggacgcaaggccaccctggaggagctgcagaccgtgcactcggaagcccacaccctc
ctgtatggcacgaaccccctcaaccggcagaaactggacagtaagaaacttctaggctcg
ctggcctccgtgttcgtccggctcccctgcggtggtgttggggtggacagtgacaccatc
tggaatgaggtgcactcagcaggggccgcccgcctggccgtgggctgcgtggtggagctg
gtcttcaaggtggccacaggagaactgaagaacggctttgctgtggtccgcccccttgga
caccacgcggaggagagcacgcccatgggtttttgctacttcaactccgtggctgtggca
gccaagcttctgcagcagaggttgagtgtgagcaagatcctcatcgtggactgggacgtg
caccacggaaacgggacccagcaagctttctacagcgaccccagcgtcctgtacatgtcc
ctccaccgctacgatgacgggaacttcttcccaggcagcggggctcctgatgaggtgggc
acagggccaggtgtgggtttcaacgtcaacatggctttcactggcggcctggaccccccc
atgggagacgccgagtacttggcagccttcagaacggtggtcatgcccatcgccagtgag
tttgccccggacgtggtgctggtgtcgtcaggcttcgacgccgtggagggccaccccacg
cctctcgggggctacaacctctccgccagatgttttgggtacctgacgaagcagctgatg
ggcctggctggtggccggattgtcctggcccttgagggaggccacgacctgaccgccatc
tgcgacgcctccgaagcatgcgtttctgctttgctgggaaatgagcttgatccccttccg
gaaaaggttttacagcaaagacccaatgccaatgctgtccgctccatggagaaggtcatg
gaaatccacagcaagtactggcgctgcctacaacgtgcagcctccacggcggggcgctct
ctgatcgaggctcagacttgcgagaacgacgaggccgagacggtcaccgccatggcctca
ctgtcagtgggcgtgaagcccgccgaaaagagaccagacgaggagcccatggaagaggag
ccgcccctgtag

DBGET integrated database retrieval system