KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386061
Entry
100386061         CDS       T03264                                 

Gene name
BMI1
Definition
(RefSeq) BMI1 proto-oncogene, polycomb ring finger
  KO
K11459  polycomb group RING finger protein 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc05202  Transcriptional misregulation in cancer
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100386061 (BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100386061 (BMI1)
   05206 MicroRNAs in cancer
    100386061 (BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100386061 (BMI1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     100386061 (BMI1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-Nse
Other DBs
NCBI-GeneID: 100386061
NCBI-ProteinID: XP_008998282
Ensembl: ENSCJAG00000036548
LinkDB
Position
7
AA seq 326 aa
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFASRPRKSSVNGSSATSSG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcatcgaacgaccagaatcaagatcactgagctaaatcctcacctgatgtgtgtgctt
tgtggagggtacttcattgatgccacaaccataatagaatgtctacattccttctgtaaa
acgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaaaaccagaccactactgaatataagatcagataaaactcttcaagatatcgtgtac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttctgctgatgctgccaatggctctaatgaagatagaggagaggttgcagatgaa
gataagagaattataactgatgatgagataataagcttatccattgaattctttgaccag
aacagattggatcgaaaagtaaacaaagataaagagaaatctaaggaggaggtgaatgat
aaaagatatttacgatgcccagcagcaatgactgtgatgcacttaagaaagtttctcaga
agtaaaatggacatacctaatactttccagattgatgtcatgtatgaggaggaaccgtta
aaggattattatacactaatggatattgcctacatttatacctggagaaggaatggtcca
cttcctttgaaatacagagttcgacctacttgtaaaagaatgaagatcagtcaccagaga
gatggactgaccaatgctggagaactggaaagtgactctgggagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcctagccccagtactccagtgcag
tctcctcatccacagtttcctcacatttccagtactatgaatggaaccagcaacagcccc
agcggtaaccaccaatcttcttttgccagtagacctcgaaaatcatcagtaaatgggtca
tcagcaacttcttctggttga

DBGET integrated database retrieval system