KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386093
Entry
100386093         CDS       T03264                                 

Gene name
ABCC8
Definition
(RefSeq) ATP binding cassette subfamily C member 8
  KO
K05032  ATP-binding cassette subfamily C (CFTR/MRP) member 8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc02010  ABC transporters
cjc04911  Insulin secretion
cjc04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100386093 (ABCC8)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100386093 (ABCC8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100386093 (ABCC8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100386093 (ABCC8)
Transporters [BR:cjc02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    100386093 (ABCC8)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MTABC_N AAA_29 ATPase AAA_25 RsgA_GTPase Zeta_toxin
Other DBs
NCBI-GeneID: 100386093
NCBI-ProteinID: XP_017833952
Ensembl: ENSCJAG00000009368
LinkDB
Position
11
AA seq 1666 aa
MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFMLLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAVTS
VVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDHAISFSQLRFCLTGLLVILYG
MLLLVEINVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDVQGTQGARAIWQALSHAFGRRLV
LSSTFRILADLLGFAGPLCIFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFCTRVEMTRKKEMTSLRAFAIYT
SISIFMNTAIPIAAVLITFMGHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFLSSAEIREEQCAAREPMPQGPASKYQAVPLKVVNRKRPAREDCRGLT
GALQSLVHSTDGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLAALGEMQKVSGAVFWSSSLPDSETGEDPSPERETATNLDIRKRGPVAYASQIPWLL
NATVEENIIFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERVSMNLGDHAAFFRM
NSANMCKFLLSARREVGKQVDRARPLSCCELTRPTLGASPGISSSERVPKLEESNCNGFY
THCHPSLPYLSLPSPPFSSAQDDPFSALDIHLSDHLMQAGILELLRDDKRTVVLVTHKLQ
YLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEP
PQGLPRAMSSRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILL
LSLLVFSQLLKHMVLVGIDYWLAKWTDSALTLTPVARNCSLSQECILDQTVYAMVFTVLC
SLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTI
DQVQRTVPHFPWSRDTLGSWGLLLSEAGFPRSGDHGPLGGSQCLRWQVELGFRPRPSPEP
ALLTIPLCPRHRDLQQLDDTTQLPLLSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNN
IASLFLTAANRWLEVRMEYIGACVVLIAAVTSISNSLHRELSAGLVGLGLTYALMVSNYL
NWMVRNLADMELQLGAVKRIHGLLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYD
SSLKPVLKHVNALISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPL
HTLRSRLSIILQDPVLFSGTIRFNLDPERKCSDSTLWEALEIAQLKLVVKALPGGLDAII
TEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENILQKXVMTASQTHCVTI
AHRVHTILSADLVIVLKRGAILEFDKPEKLLSQKDSVFASFVRADK
NT seq 5001 nt   +upstreamnt  +downstreamnt
atgcccctggccttctgcggtagcgagaaccactcggccgcctaccgggtggaccagggc
gtcctcaacaacggctgcttcgtggacgcgctcaacgtggtgccgcacgtcttcctgctc
ttcatcaccttccctatcctcttcatcggatggggcagtcagagttccaaggtgcacatc
caccacagcacatggcttcacttccctgggcacaatcttcggtggatcctgaccttcatg
ctgctcttcgtcctggtgtgtgagattgcagagggcatcctttctgatggggtgaccgag
tcccgccacctccacctttacatgccagctgggatggcattcatggctgctgtcacctct
gtggtctactatcacaacatcgagacttccaacttccccaagctgctgatagccctgttg
gtatattggaccctggccttcatcaccaagaccatcaagtttgtcaagttcttggaccac
gccatcagcttctcacagctgcgcttctgcctcacggggctgctggtgatcctctatggg
atgctgctcctcgtggagatcaatgtcatcagggtgaggagatacatcttcttcaagaca
ccaagagaggtaaagccacctgaggacctgcaggacctgggggtgcgcttcctgcaaccc
tttgtgaatctgctgtccaaaggcacctactggtggatgaatgctttcatcaagacggcc
cacaaaaagcccatcgacttgcgagccatcgggaagctgcccatcgccatgagagccctc
accaactaccagcggctctgcgaggcctttgacgcccaggtgcggaaggacgttcagggc
actcaaggtgcccgggccatctggcaggcactcagccacgccttcgggaggcgcctggtc
ctcagcagcactttccgcatcttggccgacctgctgggcttcgctgggccactgtgcatc
tttgggatcgtggaccaccttgggaaggagaatgacgtcttccaacccaagacacaattt
cttggggtttactttgtctcatcccaagagttccttgccaatgcctacgtcttagccgtg
cttctgttccttgccctcctactgcaaaggacgtttctgcaagcatcctactatgtggcc
attgaaactggaattaacttgagaggagcaatacagaccaagatttacaataaaattatg
cacctgtccacctccaacctgtccatgggagaaatgactgctgggcagatctgtaacctg
gttgccatcgacaccaatcagctcatgtggtttttcttcttgtgcccaaacctctgggct
atgccagtacagatcatcgtgggtgtgattctcctctactacatccttggagtcagtgcc
ttaattggagcggctgtcatcattctgctggctcctgtccagtactttgtggccaccaag
ctgtctcaggcccagcggagcacactggagtattccaatgagcggctgaagcagaccaac
gagatgctccgtggcatcaagctgctgaagctgtacgcctgggagaacatcttctgcacg
agggtggagatgacccgcaagaaggagatgaccagcctcagggcctttgccatctatacc
tccatctccattttcatgaatactgccatccccatcgcagctgttctcataaccttcatg
ggccacgtcagcttcttcaaagaggctgacttctcaccctctgtggcctttgcctccctt
tccctcttccacatcttggtcacaccgctgttcctgctgtccagcgtggtccgatctacc
gtcaaagctctagtgagcgtgcaaaagctgagtgagttcctgtccagtgcagagatccgc
gaggagcagtgtgcagcccgtgagcccatgccccagggcccagccagcaagtaccaggca
gtgcccctcaaggttgtgaaccgcaagcgtccagcccgggaggactgtcggggactaacg
ggcgccctgcagagcctggttcacagcacagatggcgatgctgacaactgctgtgtccag
atcatgggaggctacttcacgtggaccccagatggaatccccacactgtccaacatcacc
attcgtattccccgaggtcagctgaccatgatcgtggggcaggtgggctgtggcaagtcc
tcgctccttctagctgcactgggggagatgcagaaggtctcaggggctgtcttctggagc
agcagccttcctgacagcgagacaggagaagaccccagcccagagcgggagacagcgacc
aacttggatatcaggaagagaggcccagtggcctatgcctctcagataccatggctgctg
aatgccactgtggaggagaacatcatctttgagagtcccttcaacaaacaacggtacaag
atggtcattgaagcctgctctctgcagccagacatcgacatcctgccccatggagaccag
acccagattggggaacgggttagtatgaatcttggggatcatgctgccttcttccgaatg
aattcagcaaacatgtgcaagttccttctctctgcaaggcgagaagtgggcaagcaagtg
gacagagctaggcctctgtcctgttgtgaactgactcgccccacattgggcgccagcccg
ggaatctcgtccagcgagagggtcccaaaactggaagagagcaactgtaatgggttttat
actcattgtcacccctccctgccatacctgtccctaccttctcctcctttctcctctgct
caggatgaccccttctcagctctggatatccatctgagtgaccacttgatgcaggctggc
atccttgagctgctccgggacgacaagaggacagtggtcctagtgacccacaagctacag
tacctgccccatgcagactggatcattgccatgaaggatggtaccatccagagggagggt
accctcaaggacttccagagatctgagtgccagctctttgagcactggaagaccctcatg
aatcgtcaggaccaagagctggagaaggagactgtcacagagagaaaagccacagagcca
ccccagggcctacctcgtgccatgtcctcgagggatggccttctgcaggatgaggaagag
gaggaagaggaggcagctgagagcgaggaggatgacaacctgtcatccatgctgcaccag
cgggcggagatcccgtggcgagcctgcgccaagtacctgtcctccgccggcatcctgctc
ctgtcgctgctggtcttctcacagctgctcaagcacatggtcctggtggggatcgactac
tggctggccaagtggactgacagtgccctgaccctgacccctgtggccaggaactgctcc
ctcagccaggaatgcatcctcgaccagactgtctacgccatggtgttcacggtgctctgt
agcctgggcatcgtgctgtgcctcgtcacgtctgtcaccgtggagtggacagggctgaag
gtggccaagaggctgcatcgcagcctgctcaacaggatcatcctagcccccatgaggttt
tttgagaccacgccccttgggagcatcctgaacagattttcatccgactgtaacaccatc
gaccaggtacagaggactgtgccacattttccctggtccagagacaccctgggctcctgg
gggcttctcctgtctgaggctgggttccctagatcaggtgatcacggccctctgggagga
agccagtgtctccggtggcaggtagagctaggcttcaggcccaggccaagccctgagcct
gccctcttaactattccactctgtccccgccacagggacctgcagcagctggatgacacc
acccagcttccgttgctctcacactttgctgaaactgtggaagggctcaccaccatccgg
gccttcaggtatgaggcccggttccagcagaagcttctcgaatacacagactccaacaac
attgcttccctcttcctcacagctgccaacagatggctggaagtccgaatggagtacatt
ggtgcatgtgtggtgctcattgcggccgtgacctccatctccaactccctgcacagggaa
ctctctgctggcctggtgggcctgggcctcacctacgccctaatggtctccaactacctc
aactggatggtgaggaatctggcagacatggagctccagctgggggccgtgaagcgcatc
cacgggctcctgaaaaccgaggcagagagctacgagggactcctggcaccatcgctgatc
ccgaaaaactggccagaccaagggaagatccagatccagaacctgagcgtgcgctatgac
agctccctgaaaccggtgctaaagcacgtcaatgctctcatctctccgggacagaagatt
gggatctgcggccgcacaggcagtgggaagtcctccttctctcttgccttcttccgcatg
gtggacatgttcgaagggcgcatcatcattgatggcattgacatagccaaactgccgctg
cacaccctgcgctcacgcctctccatcatcctgcaggaccccgttctcttcagcggcacc
atccgatttaacctggacccggagagaaagtgctcagacagcacgctgtgggaagccctg
gaaatagcccagctgaagctggtggtgaaggcactgccaggaggcctcgatgccatcatc
acagaaggtggggagaatttcagccagggccagaggcagctgttctgcctggctcgggcc
ttcgtgaggaagaccagcatcttcatcatggacgaggccacagcttccatcgacatggcc
acggaaaacatccttcaaaagnntgtgatgacagcttcgcagacgcactgtgtcaccatc
gcgcatcgcgtgcacaccatcctgagtgcagacctggtgatcgtcctgaagcggggagcc
atccttgagttcgacaagccagagaagctgcttagccaaaaggacagtgtcttcgcctcc
ttcgtccgtgcagacaagtga

DBGET integrated database retrieval system