KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386129Help
Entry
100386129         CDS       T03264                                 

Gene name
DIAPH1
Definition
(RefSeq) diaphanous related formin 1
  KO
K05740  diaphanous 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04510  Focal adhesion
cjc04810  Regulation of actin cytoskeleton
cjc04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100386129 (DIAPH1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100386129 (DIAPH1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100386129 (DIAPH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100386129 (DIAPH1)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     100386129 (DIAPH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_FH3 Drf_FH1 Drf_GBD Drf_DAD DUF3450 APG6_N Glucan_synthase DUF948
Motif
Other DBs
NCBI-GeneID: 100386129
NCBI-ProteinID: XP_008984826
Ensembl: ENSCJAG00000017973
LinkDB All DBs
Position
2
AA seq 1321 aa AA seqDB search
MEPPGGGLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFLERFTSMRIKKEKEKPNSAHR
NSSTSYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYL
YTSKAGMSQKESSKSAMVYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLA
SLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMD
PAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIA
LKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENDDMKVQLTVFDEQG
EEDFYDLKGRLDDIRIEMDDFSEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQ
YYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLD
SELTARHELQVEMKKMESDFEQKLQNLQGEKDALDSEKQQIATEKQDLEAEVSQLTGEVA
KLTKELEDAKKEMASLSVAAVAIAPSVPSSATVPPAPPLPGDSGTIIPPPPAPGGSTIVP
PPPPPPPPLPGGVCIPSPPSLPGVTAISPPSSFPGGASIPPPPPLPGGASIPPPPPLPGG
ASIPPPPPLPGGASIPPPPPLPGGASIPPPPPLLGGAGIPPPPPPLPGGASIPPPPPLPG
GASIPPPPPLLGGAGIPPPPPPLPGGAGIPPPPPPLPGGVGIPPPPPPLPGGPGIPPPPP
FPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPEVQLRRPNWSKFVAED
LSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKV
LDSKTAQNLSIFLGSFRMAYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELK
DEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSE
SFSSLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDY
PDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMT
SFVKDAQEQYNKLRMMHSNMESLYKELGEYFLFDPKKLSIEEFFMDLHNFRNMFLQAIKE
NQKRRETEEKMKRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAA
FRRKRGPRQANRKAGCAVTSLLASELTKDDAMTTAPAKVPKMNEAVPTILEESMELVGRA
S
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atggagccacccggcgggggcctggggcccggccgcggtacccgggacaagaagaagggc
cgaagcccagatgagctgccttcggcgggcggcgacggcggcaaatctaagaaatttctg
gaaagatttaccagcatgagaattaagaaggagaaggaaaagcccaattctgctcataga
aattcttctacatcatatggggatgatcctacagcacagtcgttgcaagatgtttcagat
gaacaagttctggttctctttgaacagatgctgctggatatgaatctgaatgaggagaaa
caacaacctttgagggagaaggacatcatcatcaagagggagatggtgtcccagtacttg
tatacttccaaggctggtatgagtcagaaggaaagctctaagtctgcgatggtgtatatt
caggagttgaggtcaggcttgcgggatatgcctctgctcagctgcctggagtcccttcgt
gtctctctcaacaacaaccctgtcagttgggtgcaaacatttggtgccgaaggcttggcc
tccttattggacattcttaaacgacttcatgatgagaaagaagagactgctgggagttat
gatagccggaacaagcatgagatcattcgctgcttgaaagcttttatgaacaacaagttt
ggaatcaagaccatgttggagacagaagaaggaatcctactgctggtcagagccatggat
cctgctgttcccaacatgatgattgatgcagctaagctgctctctgctctttgtattcta
ccacaaccagaggacatgaatgaaagggttttagaggcaatgacagaaagagctgagatg
gatgaagtggaacgtttccagccactgctggatggattaaaaagtgggacctctattgca
ctgaaggttggatgcctacagctgattaatgctctcatcacaccagctgaagaacttgac
ttccgagttcacatcagaagtgaactgatgcgcttggggctacatcaggtgttgcaggac
cttcgagagattgaaaatgatgatatgaaagtgcaactaactgtgtttgatgaacaaggg
gaagaggatttctatgacctgaagggacggctggatgacattcgcatagagatggatgac
tttagtgaagtcttccagattctcttaaacacagtgaaggattcaaaggcagagccacac
ttcctttccatcctgcagcacttactcttggtccgaaatgactatgaggccagacctcag
tactataagttgattgaagaatgtatttcccaaatagttctacacaagaatggggctgat
cccgacttcaagtgccggcacctccagatagaaattgagggattaattgatcaaatgatt
gataagacaaaggtggagaaatctgaagccaaagctgcagagctggaaaagaagctggac
tcagagttaacagcccgacatgagctacaggtggaaatgaaaaagatggaaagtgacttt
gagcagaagcttcaaaatcttcagggagaaaaggatgcactggattctgaaaagcaacag
attgccacagagaaacaggatctagaagcagaggtgtcccagctcacaggagaggttgcc
aagctgacaaaggaactggaagatgccaagaaagaaatggcttccctctctgtggcagct
gttgctatagctccttctgttcctagtagtgctactgttccccctgcccctcctttacct
ggtgactctggcactattattccaccaccacctgctcctgggggtagtaccatagttcct
cctcctcctccaccaccacctcctttgcctgggggtgtttgcatcccctcacccccttct
ttacctggagttactgctatctctccaccctcttcttttcctgggggtgctagcatccct
ccaccccctcctttgcctgggggtgctagcatccctccacctcctcctttgcctgggggt
gctagcatccctccacctcctcctttgcctgggggtgctagcatccctccacctcctcct
ttgcctgggggtgctagcatccctccacctcctcctttgcttggtggtgctggaatcccc
ccaccaccccctcctttgcctgggggtgctagcatccctccaccccctcctttgcctggg
ggtgctagcatccctccacctcctcctttgcttggtggtgctggaatccccccaccgccg
cctcctttgcctggtggtgctggaatccccccaccacctcctcccttgcctgggggagta
ggaataccacctcctcctccccctcttcctggtggtcctggaatccctccacctcctcct
tttcctggaggccctggtattcctccacctccacctggcatgggtatgcctccacctccc
ccatttggatttggagttcctgcagccccagttctgccatttggattaacccccaaaaag
ctttataagccagaggtgcagctccggaggccaaactggtccaagtttgtggctgaggac
ctctcccaggactgcttctggacaaaggtgaaggaggaccgctttgagaacaatgaactt
ttcgccaaacttacccttacgttctctgcccagaccaagacttccaaagccaagaaggat
caagaaggtggagaagaaaagaaatctgtgcaaaagaaaaaagtaaaagagttaaaggtg
ttggattcaaagaccgcccagaatctctcaatctttttgggttccttccgcatggcctat
caagagattaagaatgtcatcctggaggtgaatgaggctgttctgactgagtctatgatc
cagaacctcattaagcaaatgccagagccagagcaattaaaaatgctttctgaactgaag
gatgaatatgatgacctggctgagtcagagcagtttggtgtagtgatgggcactgtgccc
cgactgcggcctcgcctcaatgccattctcttcaagctacaattcagcgagcaagtggag
aacatcaagccagagattgtgtctgtcactgctgcatgtgaggagttacgcaagagtgag
agcttttccagtctcctcgagattaccttgcttgttggaaactatatgaatgctggctcc
agaaatgctggagcttttggcttcaatatcagcttcctctgtaagcttcgagacaccaag
tccacagatcagaagatgacgttgttacacttcttggctgagttgtgtgagaatgactat
cctgatgtcctcaagtttccagacgaacttgcccatgtggagaaagccagccgagtctct
gctgaaaacttgcaaaagaacctagatcagatgaagaaacagatttctgatgtcgaacgt
gatgttcagaatttcccagctgccacagatgaaaaagacaagtttgttgaaaaaatgacc
agctttgtgaaggatgcccaggaacagtataacaagctgcggatgatgcattctaacatg
gagagcctctataaggagctgggcgagtacttcctctttgacccaaagaagttatctatt
gaagaatttttcatggatcttcacaattttcgtaatatgtttttgcaagcaatcaaggag
aaccagaagcggcgggagacagaagaaaagatgaagcgagcaaaactagccaaggagaaa
gcagagaaggagcggctagagaagcagcagaagagagagcagctcatagacatgaatgca
gagggcgatgagacaggtgtaatggacagtcttctagaagccctgcagtcaggggcagca
ttccgacggaagagaggaccccgtcaagccaacaggaaggccgggtgtgcagtcacatct
ctgctagcttcggagctgaccaaggacgatgccatgaccactgctcctgccaaggtgccc
aagatgaatgaggccgtccccacaatccttgaggaatccatggagttggttggccgtgca
agctaa

DBGET integrated database retrieval system