KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386176Help
Entry
100386176         CDS       T03264                                 

Gene name
COL1A1
Definition
(RefSeq) collagen type I alpha 1 chain
  KO
K06236  collagen, type I, alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04512  ECM-receptor interaction
cjc04611  Platelet activation
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04974  Protein digestion and absorption
cjc05146  Amoebiasis
cjc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100386176 (COL1A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100386176 (COL1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100386176 (COL1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100386176 (COL1A1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100386176 (COL1A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100386176 (COL1A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100386176 (COL1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100386176 (COL1A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100386176 (COL1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100386176 (COL1A1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   100386176 (COL1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI VWC
Motif
Other DBs
NCBI-GeneID: 100386176
NCBI-ProteinID: XP_008988203
Ensembl: ENSCJAG00000003818
LinkDB All DBs
Position
X
AA seq 1465 aa AA seqDB search
MFSFVDLRLLLLLAAAALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRALVEKPEPCR
ICVCDNGKVLCDDVICDETKNCPGAEIPEGECCPVCPDGSEATTDRETTGVEGPKGDTGP
RGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPG
PMGPSGPRGLPGPPGSPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPG
RPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPG
QMGPRGLPGERGRPGPPGPAGARGNDGATGAAGPPGPTGPAGPAGFPGAVGAKGEAGPQG
PRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSG
PQGPSGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTG
LPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKG
LTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERG
VPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPG
EQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPG
SQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPG
DKGETGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAG
PPGPAGPAGPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPG
PAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRG
VVGLPGQRGERGFPGLPGPSGEPGKQGPSGTSGERGPPGPMGPPGLAGPPGESGREGAPG
AEGSPGRDGSPGPKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPIG
PVGSRGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAG
PRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSGGFDFS
FLPQPLKRRAHDGGRYYRADDANVVRDRDLEVDTTLKXLSQQIENIRSPEGSRKNPARTC
RDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPNVAQKNWYISKNPK
DKRHVWFGESMTDGFQFEYGGEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQ
QTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPI
IDVAPLDIGAPDQEFGFDVGPACFL
NT seq 4398 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctttgtggacctccggctcctgctcctcttagcggccgccgccctcctgacg
cacggccaagaggaaggccaagtcgagggccaagacgaagacatcccaccaatcacctgc
gtacagaacggcctcaggtaccatgaccgagccttagtagagaaacccgagccctgccgg
atctgcgtctgcgacaacggcaaggtgttgtgtgatgacgtgatctgtgatgagaccaag
aactgccccggtgccgaaatccccgagggcgagtgctgtcccgtctgccccgacggctca
gaggccaccaccgaccgagaaaccaccggcgtcgagggccccaagggagacactggcccc
cgaggcccaaggggacccgcaggcccccctggccgagatggcatccccggacagcctgga
cttcccggaccccccggaccccccggacctcccggaccgcctggcctcggaggaaacttt
gctccccagctgtcttatggctatgatgagaaatcaacaggaggaatttccgtgcctggc
cctatgggtccctctggtcctcgtggtctccctggcccccctggttcacctggtccccaa
ggcttccaaggtccccctggtgagcctggcgagcctggagcttcaggtcccatgggtccc
cgaggtccccccggtccccctggaaagaacggagatgatggggaagctggaaaacctggt
cgtcctggtgagcgtgggcctcctgggcctcagggtgctcgaggattgcctggaacagct
ggcctccctggaatgaagggacacagaggcttcagtggtttggatggtgccaagggagat
gctggtcctgctggtcccaagggtgagcctggcagccctggtgaaaatggagctcctggt
cagatgggcccccgtggtctgcctggtgagagaggtcgccctggaccccctggccctgct
ggtgctcgtggaaatgatggtgctactggtgctgctggcccccctggtcccactggcccc
gctggtcctgctggcttccctggtgctgttggtgctaagggtgaagctggtccccaaggg
ccccgaggctctgaaggtccccagggtgtgcgtggtgagcctggcccccctggccctgct
ggtgctgctggccctgctggaaaccctggtgctgacggacagcctggtgctaaaggtgcc
aatggtgctcctggtattgctggtgctcctggcttccctggtgcccgaggcccctctgga
ccccagggccccagcggccctcccggtcccaagggtaacagtggtgaacctggtgctccc
ggcagcaaaggagacactggtgccaaaggagaacccggccctgttggtgttcaaggaccc
cctggccctgctggagaggaaggaaagcgaggagcccgaggtgaacccggacccactggc
ctgcccggaccccctggcgaacgcggtggacctggtagccgtggtttccctggcgccgat
ggtgttgctggtcccaagggtcccgctggtgaacgtggttctcccggccctgctggcccc
aaaggatctcctggtgaagctggtcgtcccggtgaagctggcctgcctggtgccaagggt
ctgactggaagccctggcagccccggtcctgatggcaaaactggcccccctggtcccgct
ggtcaagatggtcgccccggacccccaggccctcctggtgcccgtggtcaggctggtgtg
atgggatttcctggacctaaaggtgctgctggagagcccggcaaggctggagagcgaggt
gttcctggaccccctggtgctgttggtcctgctggcaaagatggagaggctggagctcag
ggaccccctggccctgctggtcccgctggtgagagaggtgaacaaggtcctgctgggtcc
cccggattccagggtctccctggacccgctggtcctcctggtgaagcaggcaaacctggt
gaacagggtgttcctggagaccttggtgcccccggcccctctggagcaagaggcgagaga
ggcttccctggcgagcgtggtgtgcaaggtccccctggtcctgctggtccccgtggggcc
aatggtgctcccggcaacgatggtgctaagggtgatgctggtgctcctggagcccccggt
agccagggtgcccctggccttcagggaatgcctggtgaacgtggtgcagctggccttcca
gggcctaagggtgacagaggtgatgctggtcccaaaggtgctgatggctctcctggcaaa
gatggcgtccgtggtctaactggccccattggtcctcctggccctgctggtgcccctggt
gacaagggtgaaaccggtcccagcggccctgctggtcccactggagctcgtggcgcccct
ggagaccgtggtgagcctggtccccctggccctgctggcttcgctggcccccccggtgct
gatggccaacctggtgctaaaggcgaacctggagatgctggtgctaaaggcgatgctggt
ccccctggccctgccggacccgctggcccccctggccccattggtaacgttggtgctcct
ggacccaaaggtgctcgcggcagcgctggtccccctggtgctactggtttccctggtgct
gctggccgagtcggtcctcctggcccttccggaaatgctggaccccctggccctcctggt
cctgctggcaaagaaggcggcaaaggtccccgtggtgagactggccctgctggacgtcct
ggtgaagttggcccccctggtccccctggccctgctggagagaaaggatcccctggtgct
gatggacctgctggtgctcctggtactcccggacctcaaggtattgctggacagcgtggt
gtggtcggcctgcctggtcagagaggagaaagaggcttccctggtcttcctggcccctct
ggtgaacctggcaaacaaggtccctctggaacaagtggtgaacgtggtccccctggtccc
atgggcccacctggattggccggaccccctggtgaatctggacgtgagggagctcctggc
gctgaaggttcccctggacgagatggttctcctggccccaagggtgaccgtggtgagact
ggccccgctggaccccctggtgctcctggtgctcctggtgcccctggccccgttggccct
gctggcaagagtggtgatcgtggtgagactggtcctgctggtcccgccggtcctatcggc
cctgttggctcccgtggccccgctggaccccaaggcccccgtggtgacaagggcgagact
ggtgaacagggtgacagaggcataaagggtcaccgtggcttctctggcctccagggtccc
cctggccctcccggctctcctggtgaacaaggtccctctggagcctctggtcctgctggt
ccccgaggtccccctggctctgctggtgctcctggcaaagatggactcaacggtctccca
ggccccatcgggccccctggtcctcgcggtcgcactggtgatgctggtcctgttggtccc
cccggccctcctggccctcctggtccccctggtcctcccagcggtggtttcgatttcagc
ttcttgccccagccactcaagaggagggctcacgatggtggccgctactaccgggctgat
gatgccaatgtggttcgtgaccgtgacctcgaggtggacaccaccctcaagnagctgagc
cagcagatcgagaacatccggagccctgagggcagccgcaaaaaccccgcccgcacctgc
cgcgacctcaagatgtgccactctgactggaagagcggagagtactggattgaccccaac
caaggctgcaacctggatgccatcaaggtcttctgcaacatggagactggagagacctgc
gtgtaccccactcagcccaacgtggcccagaagaactggtacatcagcaagaaccccaag
gacaagaggcacgtgtggtttggcgagagcatgaccgacggattccagttcgagtatggt
ggtgagggctccgaccctgccgatgtggccatccagctgaccttcctgcgcctgatgtcc
accgaagcctcccagaacatcacctaccactgcaagaacagcgtggcctacatggaccag
cagactggcaacctcaagaaggctctgctcctccagggctccaacgagatcgagatccgc
gccgagggcaacagccgcttcacctacagcgtcaccgtcgatggctgcacgagtcacact
ggagcctggggcaagacagtgatcgaatacaaaaccaccaagacctcccgcctgcccatc
atcgatgtggcccccttggacattggcgccccagaccaggaattcggcttcgacgttggc
cctgcctgcttcctgtaa

DBGET integrated database retrieval system