KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386369Help
Entry
100386369         CDS       T03264                                 

Gene name
PPP3CA
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04114  Oocyte meiosis
cjc04218  Cellular senescence
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04625  C-type lectin receptor signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04720  Long-term potentiation
cjc04724  Glutamatergic synapse
cjc04728  Dopaminergic synapse
cjc04921  Oxytocin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04924  Renin secretion
cjc05010  Alzheimer disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05031  Amphetamine addiction
cjc05152  Tuberculosis
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100386369 (PPP3CA)
   04310 Wnt signaling pathway
    100386369 (PPP3CA)
   04370 VEGF signaling pathway
    100386369 (PPP3CA)
   04020 Calcium signaling pathway
    100386369 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    100386369 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100386369 (PPP3CA)
   04218 Cellular senescence
    100386369 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100386369 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    100386369 (PPP3CA)
   04660 T cell receptor signaling pathway
    100386369 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    100386369 (PPP3CA)
   04659 Th17 cell differentiation
    100386369 (PPP3CA)
   04662 B cell receptor signaling pathway
    100386369 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100386369 (PPP3CA)
   04921 Oxytocin signaling pathway
    100386369 (PPP3CA)
   04924 Renin secretion
    100386369 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100386369 (PPP3CA)
   04728 Dopaminergic synapse
    100386369 (PPP3CA)
   04720 Long-term potentiation
    100386369 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100386369 (PPP3CA)
   04380 Osteoclast differentiation
    100386369 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100386369 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100386369 (PPP3CA)
   05014 Amyotrophic lateral sclerosis (ALS)
    100386369 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100386369 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100386369 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100386369 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    100386369 (PPP3CA)
   05163 Human cytomegalovirus infection
    100386369 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100386369 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100386369 (PPP3CA)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100386369 (PPP3CA)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100386369 (PPP3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 100386369
NCBI-ProteinID: XP_002745594
Ensembl: ENSCJAG00000015260
UniProt: F6ZPA8
LinkDB All DBs
Position
3
AA seq 521 aa AA seqDB search
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgacggacagggtggtgaaagct
gttccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcacatcttatgaaggagggaaggctggaagagagtgtt
gcattgagaataataacagaaggtgcatcaattcttcgacaggaaaaaaacttgctggat
attgatgcgccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctctttgaagtcgggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgacgcctgtatggat
gcctttgactgccttcccctggctgccctgatgaaccagcagttcctgtgtgtacacggt
ggtttgtctccagagattaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcatatggacctatgtgtgatatcctgtggtcagaccccctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatacttcgagcc
catgaagcccaagatgcagggtaccgcatgtacaggaaaagtcaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtatacaataataaggctgca
gtattgaagtatgagaacaatgttatgaatatcaggcagttcaactgttctcctcatcca
tactggcttccaaatttcatggatgtttttacttggtccctgccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaactagggtccgaa
gaagatggatttgatggtgcaaccgctgcagcccggaaggaggtgatcaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagtgctcagagaagagagtgagagtgtg
ctgacgctgaaaggcttgaccccaactggcatgctccccagtggagtactttctggaggg
aagcaaaccttgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaagccaagggcttagaccgaattaac
gagaggatgccgcctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcacctcagagactaacggcacggacagcaatggcagcaatagcagcaatatt
cagtga

DBGET integrated database retrieval system