KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386453
Entry
100386453         CDS       T03264                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc03013  RNA transport
cjc04012  ErbB signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04218  Cellular senescence
cjc04910  Insulin signaling pathway
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05221  Acute myeloid leukemia
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100386453 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100386453 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    100386453 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    100386453 (EIF4EBP1)
   04152 AMPK signaling pathway
    100386453 (EIF4EBP1)
   04150 mTOR signaling pathway
    100386453 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100386453 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100386453 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    100386453 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100386453 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100386453 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100386453 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    100386453 (EIF4EBP1)
   05165 Human papillomavirus infection
    100386453 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100386453 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100386453 (EIF4EBP1)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100386453 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 100386453
NCBI-ProteinID: XP_002757000
Ensembl: ENSCJAG00000002671
UniProt: F6Y074
LinkDB
Position
13
AA seq 118 aa
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPAIPGVTSPAGDEPPTEASQSHLRNSPEDKRAGSEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccgggggcagcagctgcagccagaccccaagccgagccatccccgccactcgccgg
gtggtgctcggcgacggcgtgcagctcccgcccggggactacagtacgacccccggaggc
acgctcttcagcaccaccccgggaggtaccaggatcatctacgaccggaaattcttgatg
gagtgtcggaactcacctgtgaccaaaacacccccaagggatctgcctgccattcctggg
gtcaccagccctgccggtgatgagccccccacggaagccagccagagtcacctgcgaaat
agcccagaagataagcgggcaggcagtgaagagtcacagtttgaaatggacatttaa

DBGET integrated database retrieval system