KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386866Help
Entry
100386866         CDS       T03264                                 

Gene name
ZNF469
Definition
(RefSeq) zinc finger protein 469
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-C2H2_2
Motif
Other DBs
NCBI-GeneID: 100386866
NCBI-ProteinID: XP_003735402
LinkDB All DBs
Position
20
AA seq 3811 aa AA seqDB search
MPGERPRGVPAPTMTGDLQPCHVASSLGCPSQAPLEDHSPASRTTKGAREVGRQAQAMEL
PEAQPRQARDGEPQPPPLRGQALSSTPRKGGGPQTPPGRSPLQASSRLVGKAAGSPPKHY
SLSITSSRAKATLEQMPENPPLEAAQPPEVEAPQGPGTGAPLRPGLPRTTAQPTAEELGF
HSSFQETPSSFTSTNYTSPSATPRPPATGPPQSRGASPIHPSPYPELQASGADSWPPAAE
NSFRGANFGAPPAESEPIPTGSRPGSSPTGASFQFPFPALHGAGANPFPANVASHTFTDG
PLVFAFHQPQGAWLEETVGAGPAYPLPTPSAPSPLPCYQGQPGGLSPHSNLSGALSPPEA
AHSAPRPFDGLHKTLPWPQVLPTAGPSPHRMEMPSRLPVPAGAPEWQEDSHRALSSAGKT
PGPEEKLAAVRSGRDTSPALFTYSGLTDPGAQPLFFSMAQAQVPPHGTPRVVGASPSESP
LPSPATNTASSTCSSLSPMSNSPANPSSEESQLPGPRGPSAFFHPPTHPQETGSPFPSPE
PPHSLPTHYQPEPAKAFPLPADGLGAEGTFQCLEETPFPHEGPEVGRGGLQGFPRVPPLC
PAHHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGVLLARAKDGHPRSPGPAG
LSSPTTAPRVPADAHPSMLSHSKAFLPAEDVQAEGKDDPLRTGFLPSLAATPFPLPASDL
DMEDDAKLDSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGLRGPSTGQPPKTKAGVT
PENRAPPPLPTATPDPQAPRPGDRGCPARGRPKTRSLGLAPTEVDAPSQGRQQRRGKQLK
LFQKDLDTSTAEGLGVGGRTALRPRRRKGSHGQRPPPCPRDLRTQDPESHADPTPQVRRA
ATLPEETRSSPRLRLPPRKDSRRRKAGDGAWGKELILKIVQQKNKLQEYNYASESEEDQP
PPQQGPGFRGRRCRGAKRKEVDLTQGPREDGERQKHGKAVRQGAGGDRAPHNPEEPGRPC
RDPNRSSEADGPLPNLEAGVAARETAKCADGPSLAPKDPLQVPTNTQTPKENRPPLDFPQ
EAKEPEIVKGSPVDTTELTEVLSSSPASCAEGSPSLLIPEQPQPSRQDTGSPKLSGSLAN
MVPHTTLAPLRGAPAPGMGGLLDGPGCTKAPISHNREEPPARHPAEFLAPMANPLSTACP
KPGILSSKVSGFGCDPAGFNGDPMGVPVAKKGPQSYGSPHSELFLGPKDLAGCFLEDLHP
KPSAMDAPPASNSCLCQDGKDAGSLEPLLPKSLPGTAETDAGRATSPLTLESTSLFPGLP
LDRFNPPLYGSLSADRGPQVPFTCADPPQKQPPSDPPFPSFLLLEEVPPMLPNHFPDPSG
GKVLSKTCPPEQTAAPGTSALPGKGSGCSAALMSHLSEDELEIQKLVTELESQLQRSKDT
PGAPRELGEAESGGRVEPGTGTEAAHLLPTCQTTMPHKDTLSAADLTVTGESAAPREGAG
PAVATMEGVQQKPTTTWPCPASFHPGETAPLPCAQEDLDSGSPFSPTGASFHFQLVQKAR
VSKTGLCLPEGDSRAPEDVCLPEPRKQPGPPLDARSLAKYSPDQELSFPKNKEVSSSQES
EDALRPLPCEQRGRLFPGPGTADGPCPEAPALEAFCSPALHLAPDLAFQGDGASPLDATW
PSGASQSHAAQGHSAGRAGGRLYPASGRPGFEGNEFAPAGASSMTSPQGRRAWFVPVPSP
TCVSDTHLSRRSQDPASSPLRQLSILGPGAAESKDGTPASQDPTPAAQSPLRGNPSDLEG
DTVKGEKVACGPALGPPEGVEVTTLPTVAGDQLGLEADGHRGSLGQAEKTQVQGRVSWPQ
PVNGGSPGGAGNLSSVNTALARPATGAVLLEKCEGLRAAMSLQGEAPHPPSLPHPPSLPP
PDRESLELALTAAHTQNAPEGGALQRASSLGLNKPMFSTGDSPAPSIGDLAACVPSPSSS
ATPTPCSLRPLPHEDPPTSPSSATGAQGGLRGQLPTSPSCRDPPSPQHLPAYSPTQAPLE
EADAIPAHTDTGAGDPPVAPLPLTTSLCDPKGALAHCILQGEDSLLEDPSSRCPGSISAT
VYTHGRGSPEDSTLRIPEDSRKEKLWESPGRATSPPLVGAVSPTMALRAADLASTLTKDA
PQAGRGPPGLEPQSRGAPSHPNPDRMPSGLSYSPSNTARLSQREAHAVTAVPTEPPTPPG
AGLDSPTCLEDEAGTSSKGPEHPGTPEAGHSGATKVPSVTCPSSGLCLGITTAPSSAASD
FQSDSPKSHRNASHQTSQEDPLGPQDLKQGPRGYKKKPVSTENSQAALGPVTCEVCTASF
RSRPGLSRHKARKHRPHLGAPPQPSPAALPAHQPPGPPTQKCQPPRKESRKAPGKERPNH
SRGDSSHIAPGLKEVLRTPGSTHSQQQRPPSPAEHGVDGKAPASKPRPGRVGEEELHPKQ
AERREGRRRRREPTGDSTSHSEGKSSQKAGKLRGRRLWEDGASAVSPEVVSDGCGSRPSL
ATASDAAPASHCLSVEGQPEADKEQPPRWTMPGPRVLEVASGTDLEALCAGETGAQKLPG
DQMLRPGRMDGTALGERPVGQKGALARGLQRPRETKALGVCREAGSTPAEDSSRAHSGSE
EGFWEELASPLGPLGFPETSSPPVDSTTSGCLQGLPENPDTQGGVQGPEGPTPEAPSSSA
KDPPSLFDDEVSFSQLFPPGGRLTQKRNPRVYGKRCEKPERQLPTQPSMEEGPTLSPACL
PTDLSDSGSLCLCHEDPWEDEDPAGLPESFLLDGFLSSRSPGIDPWASGLSLWALEPGEE
GSAEKLPSHYPEDDQPEAIPKLHMVPAAWRGLELPAPMSDASSSLGDMSPEPPSLERERY
DGGLPGNAHLLPLQAADLETLSSEFEMQDLCFLGPSEDPAGLPTTSFLDFEATASSPGPQ
NGRTEAAMEAGRAQGRGRLTKGKRASYKCRVCFQRFRSLGELDLHKLTHTPAPPPTCYMC
VERRFGSRELLRGHLQERHAQSKAGPWACGMCLKEVADIWMYNEHLREHAARFARKGQAR
RSLGDLPRGLQGGSAIAQLLSGIMEPTPKPHRDKHSGGSPGDSSGPEGEAGKESRSKRAK
PSWHSAPSHPDRAVTPDSVSANTLANLGSPAACEKPAPACGSAPLPGPAKTTPIPSPDSW
AGGEPLLQAVLVHEACKDPSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYSE
LGELLVHLGGVHRLQEPLEVQHTPLYACELCATVMHIIKKSFACSSCNYTFAKKEQFDRH
MDKHPRREWQPFTFRGVRRPGAPGQKSLALEGTLPSKRRKLAVPGSAPGPEEDSPTLSER
SLPALLQLCPEVAASTTKGWPEILERPADPGTLPIRVWDRPSDHQECPPPSLSPYPAALA
EGRGDCEPDRALERPEDEASAGSPGTLLQQALPLGASVPRPGARDQDAEGKRAPLLFSGK
RRAPAARGRGAPDHFQQDPALLPKQKQVSSSHMASEGGPGGPFHKGSATKPGGCQSSSMD
RWAASTPSKAPKFPVHPRKAVGSLAPGELACDTENGMKPDTPKAKPGPSPQGSGSPRPGT
KTGGGSQPQPASGQLQSETATTPAKPSFPSQSPAPDRLLPQAQAKSCTKGPREAGEQGPH
RSQGPKEKGESSMKRKKVQAPGAARTESVGSLGRAPSAPDKPLRTPRKQATPSRVLPAKP
KLNSQKKPRPPPSEQRKAEPGHVHRKDRLGKAFPQGRPLLRPPRRGRAVHGAEPAEPHTR
RTAEAQSDLLSQLFGQRLTGFKIPLKKDASE
NT seq 11436 nt NT seq  +upstreamnt  +downstreamnt
atgccaggggaacggccccgaggagtgccagcccccaccatgacaggagacctgcagccc
tgccacgttgccagcagcctggggtgcccctcccaggccccactggaggaccatagccca
gccagcaggactaccaagggtgctagggaggttggccgccaggcccaggccatggagctc
cctgaggcccagccgaggcaggccagggatggggagccccagcccccacccctgagaggc
caggccctgagcagcacccccaggaaggggggcggcccccagaccccaccagggaggagc
cccttgcaggcttcctcaagactggtgggcaaggcagccggcagccccccaaagcactat
agtctgagcatcaccagctcgagagctaaggccaccctggaacagatgcctgagaaccca
ccactggaggctgcccagcccccagaggtggaggccccccagggccctgggacgggagct
cccctcaggccaggcctcccgaggaccacggcccagcccactgctgaagagctcggcttc
cacagtagttttcaggagacaccctccagctttacctccaccaactatacctcaccaagc
gccacccccaggcccccagccacagggcccccccagagcaggggcgccagcccaatccat
cccagcccctatcctgaattgcaggccagtggggctgactcctggcctcccgctgctgag
aatagcttccgaggtgctaatttcggggctccccctgccgagtcggagcccattcccaca
ggcagcaggcccggcagcagccccacgggggcttccttccagttccccttcccagccctg
cacggggctggtgctaaccccttccctgcgaacgtggccagccacacattcaccgacggg
ccgctggtgtttgccttccaccagccccagggagcatggctggaagagaccgtgggagcc
ggcccagcctacccgctgcccaccccgtctgcaccctcacccctcccctgctaccagggc
cagccaggtggcctcagcccccacagcaacctcagcggtgccctgtctccgcccgaagct
gctcactcggccccgagacccttcgacggtttgcacaagaccttgccatggccccaggtg
ctcccgactgctgggccaagcccccacagaatggagatgccgagccggctacctgtccct
gcgggggcccctgagtggcaggaggacagccacagagctctgagcagtgctgggaagaca
ccgggacccgaggagaagctggcagctgtgagaagtggccgggacacctccccagcactg
ttcacctacagtgggcttacagaccccggagcccagcccctgttcttcagcatggcccag
gcccaggttccacctcacggcacacccagggtggtgggagcgtcccccagcgagtcccca
ctgccatcaccagccaccaacacggccagcagcacctgctcttcactgtcaccgatgtcc
aacagcccagccaaccccagctcagaggagagccagctccctggcccacgcgggccctcg
gccttcttccacccacccactcacccccaggagacgggcagccccttcccatcccccgag
cccccccactccctccccacccactaccagccagagccggccaaggccttccctctccct
gcagatgggctgggagctgagggtaccttccagtgcctggaggagaccccattcccccac
gagggccccgaggtgggccggggagggctgcagggtttcccccgcgtgccgccgctgtgc
cccgcacaccacttctccctcagtagcgccagcctggaccagctggacgtgctgctgacg
tgcagacagtgtgaccgcaactacagcagcctggcggccttcctggcacaccggcagttc
tgcggagtgctcctggccagggccaaggatggccacccgcgttccccgggtcctgctggg
ctctcctcgcccaccacggcccccagagtccctgccgacgcacatcccagcatgctcagc
cactcgaaggccttcctgccagctgaggatgtccaggccgaaggcaaagatgaccccctg
agaacaggcttcttacccagcctggccgccaccccgttcccactccctgcctcggacctg
gacatggaggatgatgccaagctggacagcctcatcaccgaggcgctcaacggcatggag
taccagtcagacaaccccgagatcgacagcagcttcatcgacgtcttcgcagatgaggag
ccttctggccttagaggtcccagcactgggcagccccctaagacgaaggcaggcgtgact
ccggagaacagagctccacccccactcccaacggccacaccagaccctcaagctccccgc
cctggggacagaggctgcccagcccgaggcaggcccaaaacgcgttctctgggtctggcc
cccacagaggtggacgcgcccagccagggcaggcagcagaggagagggaagcagttgaag
ctcttccagaaggatctggacaccagtacagcagaggggctgggtgtgggcggcagaact
gccctgaggcccaggaggaggaagggcagtcatgggcagcggcccccaccctgtccccgc
gacctgagaactcaggaccccgagagccatgcagaccccaccccccaggtccggagagcc
gccaccctccctgaggagaccaggagctccccacgcctccgactgccccccaggaaggac
tccaggaggaggaaggctggggatggcgcctggggcaaggagctcatcctgaagatcgtg
cagcagaagaacaagctccaggagtacaactatgcctccgagtccgaggaggaccagcct
cctccgcagcagggtcctggcttcagaggccggaggtgccgaggggcgaagaggaaggaa
gtggacttgacccagggtcccagagaggatggagagcgacagaaacacgggaaggcagtg
aggcagggagccggcggggacagagccccccacaaccccgaggaaccaggcaggccgtgt
cgggaccccaacaggagctccgaggccgacggaccactgccaaacctggaggccggagtg
gctgccagggagacagccaagtgtgctgatggcccctcactggcccccaaggatcccctg
caggtccccaccaacacccagacccccaaggaaaaccgcccaccactggacttcccccag
gaagccaaggagcctgaaattgtcaaagggtcacccgtggacaccacagaacttacagag
gttttgagttcttctccagccagctgtgcagaaggaagccccagcctcctgattccagag
cagccgcagcccagcagacaggacacgggcagccccaagctatcgggaagcctcgccaac
atggtgccccacaccaccctggcgcccctcaggggtgcaccagcgccaggcatgggcggc
ctgctggatggccctgggtgcacaaaggcccccatctcccacaacagagaggaaccccct
gcccgccatcctgcagaatttctggcacccatggctaaccccttgagtactgcctgcccc
aaacccggcatcctgtcttcaaaggtctccggttttggctgtgaccctgctggttttaat
ggagaccccatgggggttccagttgccaaaaaggggcctcagtcctatggcagcccccac
agtgagttgttccttggacctaaagacctggctggctgtttcctggaagacctgcacccc
aagccctcagccatggacgccccaccggccagcaactcctgcctttgccaggatggcaag
gatgctggctccctcgagccactgctgcctaagagcctccccggcacggccgaaacagat
gcaggcagagccacatcgccactgaccttggagtccacatccctttttccaggactgcca
ctggacagattcaacccacccctctacggcagcctgtctgcagacaggggcccccaggtg
ccgttcacatgtgctgaccctccccagaagcagcccccatcagacccaccgttcccctct
tttttgctgcttgaagaagtaccccctatgctgcccaaccattttcctgatccctcaggg
ggaaaggtgctcagtaagacgtgtccccctgaacagacagcagcccccggcacctcagct
ttgcctgggaagggtagtggatgtagtgctgctcttatgagccacctgtctgaggacgaa
ctggagatccagaaattggtcaccgaattagaaagtcaactgcaaaggagcaaagacaca
cctggggccccaagagagctcggagaagctgagtctgggggcagggtggagccaggcaca
ggcacagaggctgcccacctgctgcccacctgccagaccaccatgccccacaaggacaca
ctctcggcagctgacctcacggtcactggggaatccgctgcacctcgggagggtgcagga
ccagctgtggccaccatggaaggggttcagcaaaagcccacgacgacatggccctgccca
gcttccttccacccaggagaaacagcccctctcccctgcgcccaagaagacctggattct
gggtctcctttcagccccacgggagccagcttccattttcagctggtgcagaaagccaga
gtctccaagactggactctgcttgcctgaaggggacagcagggcccctgaagatgtctgc
ttgccagagccccgcaagcagccagggccaccactggatgccaggagtttagcaaagtac
agccctgaccaggagctttcatttcctaaaaataaggaggtcagcagctcacaagaaagt
gaagatgcccttcggccacttccctgtgaacagagaggacggcttttcccaggacccggc
accgcagacgggccctgcccagaggcccccgctctggaagccttctgcagccctgcactc
catctggcccctgacttggcatttcagggtgatggggcctcaccactggatgccacctgg
ccttctggtgccagtcagagccatgccgcccagggacattctgcaggcagagcaggtggg
cgcctctaccccgcatcagggaggcctggctttgagggtaatgagtttgcaccggcaggg
gcctcctcgatgacctccccccagggcaggagggcttggtttgtccctgtgccaagtccc
acctgtgtgtctgacacacatctcagcaggaggtcccaggacccagcctcaagcccccta
cgtcagctctcaatcctggggcccggagcagctgagagtaaagatggcaccccggcctct
caagatccaacacctgctgcccagagccctctgagagggaacccctcagatctggaaggg
gacactgtgaaaggggagaaggtggcctgtggccccgccctgggccctccagagggtgtg
gaggtgacaactctccctacagtggccggagatcagctggggctggaggcagatggacat
cgaggctctcttggccaagctgagaaaacccaggtccaaggcagagtcagctggcctcag
ccagtgaacggagggagcccagggggggcgggtaacctctcctccgtcaatacagcactg
gccaggcctgccacgggtgcagtcctgctagagaaatgcgaagggcttagggcagccatg
agccttcagggcgaggccccgcaccccccaagcctcccgcaccctccaagcctcccgccc
ccggatagggagtccctggagctagccttgacagcagcccacacccaaaatgcacctgag
ggcggggctctacagagggcatccagcctgggcctgaacaagccgatgttcagcacaggg
gatagtccagcaccctccatcggggacctggcggcctgtgtcccttcaccctcttcttca
gccacccctacgccctgcagcctcaggcccctgccccacgaagacccacccacctctccc
tccagtgccactggagcccaaggtgggctgagggggcagctgccaacatctccatcctgc
agggaccctcccagcccccagcacctgccagcctattctcctacccaggcacctctggaa
gaggcagatgctatcccagcccacacagatactggggctggggatcccccggtggctccc
ctgcctttgaccacaagcctgtgtgatcctaagggagccctggctcactgcatcctccag
ggggaggacagcctcctggaagacccttcctcccggtgtcctggctcaatcagtgccaca
gtctacactcacggcaggggcagccccgaggacagcactttaagaattccagaggattcc
agaaaagagaagctgtgggagtctcctggccgagccacctctcctcccctggtgggggct
gtctcccccaccatggccctgagggctgctgacctggccagcactctcaccaaagatgcg
ccacaggcaggcagaggacccccagggctggaaccccaaagcaggggggccccatcccac
cccaatcctgacaggatgcccagcggcctctcatattctccaagtaacactgcccgcctc
agccaaagggaagcccacgctgtcacagctgtgcccactgagcctcccacgccaccaggt
gcagggttggactcccccacctgcctggaagatgaggcggggaccagcagcaaggggcca
gagcacccagggacccctgaggctgggcattctggtgctaccaaggtgcccagtgtcacc
tgcccttcctcaggactctgcttgggcataaccacagctccaagcagcgcagcaagtgac
ttccagtctgactcccccaaaagccacagaaatgcctcccaccagacttcccaggaggac
cccctcggtccccaagacctcaaacaggggcctcgtggctataaaaagaagccagtgtct
acagagaacagccaggctgcgctcgggcctgtgacctgtgaggtctgcacagcctccttc
cgctcccggccgggcctgagccggcacaaggccaggaagcaccggccacacctgggagca
cccccacagccgagcccagcggccctgcctgctcaccagcctccggggcccccaacccaa
aagtgccagccccccaggaaggagagccgcaaggcacctgggaaggagagaccaaaccac
tcgcggggggactccagccacatcgccccgggcttgaaggaggttctcaggacacccggc
tccacgcacagccagcagcagcgccccccaagccctgctgagcatggggtggatgggaag
gctccagcctccaagccaagaccaggccgggtcggggaagaggagctccatcccaagcag
gcagagagacgagaaggccggaggcggcgcagagagcccacaggggactccaccagccac
tcagaggggaagtcaagtcagaaagcaggaaagctgagaggcagaaggctctgggaggat
ggcgcttctgcagtctctcctgaagtggtttcagatgggtgcggctcccgaccatccctc
gcaacagccagcgacgcagcccccgctagccactgcctctctgtggaaggacagcctgag
gctgacaaggagcagcctcctcgctggaccatgcctgggcctagggtgttggaggttgct
tcagggactgacctggaggctctgtgcgcaggggagactggggcccagaagctacctgga
gatcagatgcttcgtccagggaggatggacggtacagctctcggggaacggccagttggg
cagaagggagccttggccagggggctccagagaccgagagagaccaaagcattgggtgtt
tgcagagaggctgggagcacgccggcagaggacagcagcagggcccacagcgggtcagag
gaaggcttctgggaggagctcgcgagccccttgggtcccctgggttttcccgagacttcc
agccctccagtggacagcaccactagcggctgcctccagggcctcccggagaacccagac
acccagggtggggtccaggggcctgagggccccactcctgaagcccccagctccagtgcc
aaggatcctccaagcttgtttgatgatgaggtctccttctcccagctcttccctcccggc
ggccgcttgacccaaaagaggaacccacgcgtctacgggaagcgctgtgagaagccagag
cgccagctgcccacccagcccagcatggaggagggccccacactcagcccagcctgcctg
cccacggacctcagcgactccggctccctctgcctctgccatgaggatccgtgggaggac
gaggaccccgcaggtctgcccgagtccttcctcctggatgggttcctcagcagcaggtcg
cctggcatcgacccctgggcctccggcctcagcctgtgggccctggagcctggtgaggaa
ggcagtgcagagaagctgccctcccattaccctgaggacgatcagcccgaggccattccc
aaactgcacatggtcccggcagcttggcgaggcctagagctgccagcccctatgagtgat
gcctcctcttctcttggagacatgagccctgagccccccagcctggagagagaacgctat
gatggtgggctgcccgggaatgcccacctgctgccactccaggccgcggacttggagaca
ctgagctccgagtttgagatgcaagacctgtgctttctgggaccctctgaagaccccgca
ggtctcccaaccaccagcttcttagacttcgaggccacggcgagctccccggggccacag
aacggaaggacagaggcagccatggaggcggggagggcccaaggccgagggcggctgacc
aagggcaagcgggcctcctacaagtgccgggtgtgcttccagcgctttcgcagcctgggc
gagctggacctgcacaagctgacccacacacccgcgccaccgcccacctgctacatgtgc
gtggagcgcaggttcggctcgcgggagctgctccgagggcacctgcaagagagacacgcg
cagagcaaggcggggccctgggcctgtggcatgtgcctgaaggaggtggctgacatctgg
atgtacaatgagcacctgcgggagcacgccgcccggttcgcccgcaaggggcaggcgcgg
aggtctctgggggacctgcccagaggcctgcagggcggcagcgccattgcccagctcctg
agtggcatcatggaacccacacccaaaccccacagggacaagcactcaggcgggagcccg
ggagactcctcagggccggagggagaggccgggaaagagagcaggagcaagagggcgaaa
cccagctggcacagcgcccccagccacccagacagggccgtgacaccagacagcgtctct
gccaacaccctggccaacctgggcagccctgcagcctgcgagaagcccgctccggcctgc
ggctcggcccctctcccaggtcccgccaagaccacccccatcccgtcgccagactcctgg
gccggcggggagcccctcctgcaagccgtcctggtgcacgaggcctgcaaggacccctcg
cgggactgccaccactgcgggaagcgcttccccaagcccttcaagctgcagcgccacctg
gcggtgcacagcccacagcgcgtctacctgtgcccccggtgcccccgggtctactccgag
ctcggggagctgctggtgcacctgggcggggtgcacaggctgcaggagccactggaggtg
cagcacacaccactctacgcctgcgagctctgcgccacggtcatgcacatcatcaagaag
tccttcgcctgcagctcctgcaactacacctttgccaagaaggagcagtttgaccgccac
atggacaagcacccccggagggagtggcagccctttacattccgcggtgtgcggaggccg
ggagcgccagggcagaagtccctggccctcgaaggcacactgcccagcaaacggcgcaag
ctggctgtgcccggcagtgcccccgggcccgaggaggacagccccaccctgagcgagcgg
tccctccctgccctgctccagctctgcccggaggtggctgccagcaccaccaagggatgg
cccgagatcctagagaggcctgcagaccctgggaccctcccgatcagggtttgggatcgg
ccatctgaccaccaggagtgtcccccgccatctctgtctccctacccagctgccttggct
gagggcagaggggactgcgagccagacagagccctagagaggccagaggatgaggcttcc
gcaggcagccctgggactcttctccagcaagctcttccactgggggcatctgtgccacgg
ccaggagccagagaccaagatgcagagggtaagagggctcccctcctgttctcagggaaa
cgcagggccccagctgcccgaggtagaggtgcccctgaccatttccagcaagatcctgcc
ctgcttccaaaacagaagcaggtgtcctcaagccacatggcatctgaaggggggcctgga
ggccccttccacaagggcagtgccaccaagcctgggggctgccagagctcatcaatggac
aggtgggcagcatccacccccagcaaagcacccaagttcccagtgcatccaaggaaggcg
gtggggagcctggcacccggggagctggcctgtgacacagagaacgggatgaagcccgac
acccccaaagccaaaccaggccccagcccccagggcagtggaagccctcgccctggcacc
aagacaggtggtggcagccagccccagccagccagtgggcagctccagagtgagacagcc
actaccccagccaagcctagcttccccagccagagccctgcaccagacaggctcctgcct
caagcccaggccaagagctgcaccaaggggccaagggaagctggtgagcaggggccccac
aggagccagggtcccaaggagaagggagaaagcagcatgaagaggaagaaggtccaggcc
ccaggggcagccaggactgagagtgtggggagcttggggagagccccctcggcccctgac
aagcccctccggacccctcggaagcaggcaactcccagccgtgtgctcccggccaagccc
aaactcaacagccagaagaaacccaggccaccgccctcagagcagcggaaggcagagccg
ggccacgtgcacaggaaggacagactgggcaaggccttcccccaggggcgacccctgctc
aggccccccaggaggggcagagctgtccacggtgctgaacctgcagagccgcacacccgc
cggaccgccgaggcccagagtgacctccttagccagctcttcgggcagagactaactgga
ttcaaaatccctttaaagaaagatgcttctgagtaa

DBGET integrated database retrieval system