KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387025
Entry
100387025         CDS       T03264                                 

Gene name
ADCYAP1R1
Definition
(RefSeq) ADCYAP receptor type I
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04713  Circadian entrainment
cjc04911  Insulin secretion
cjc04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100387025 (ADCYAP1R1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100387025 (ADCYAP1R1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100387025 (ADCYAP1R1)
   04924 Renin secretion
    100387025 (ADCYAP1R1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100387025 (ADCYAP1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100387025 (ADCYAP1R1)
G protein-coupled receptors [BR:cjc04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    100387025 (ADCYAP1R1)
SSDB
Motif
Pfam: 7tm_2 HRM Insulin_TMD Dicty_CAR
Other DBs
NCBI-GeneID: 100387025
NCBI-ProteinID: XP_003733615
Ensembl: ENSCJAG00000008919
UniProt: F6WT00
LinkDB
Position
8
AA seq 538 aa
MSHKAPLALSKGTAFGSSARRHIGADPPLLSVGSQQCWPRSIMAGVVQVSLAALLLLPMA
PAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCP
ELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDE
YESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFML
RAISVFIKDWILYAEQDSNHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVET
FFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIM
VNFVLFIGIIVILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLR
LARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAE
IKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgagccacaaagcccccctggccctctccaaaggcacagcgtttggttcttccgcacgg
agacacattggggctgacccaccgctgctgtcagtgggaagccagcagtgctggccaaga
agcatcatggctggtgtcgtgcaggtctccctggctgctctcctcctgctgcctatggcc
cccgccatgcattctgactgcatcttcaagaaggagcaagccatgtgcctggagaagatc
cagagggccaatgagctgatgggcttcaatgattcatctccaggctgtcctgggatgtgg
gataacatcacatgttggaagcccgcccatgtgggtgagatggtcctggtcagctgccct
gaactattccgaatcttcaacccagaccaagtctgggagaccgaaaccattggagagtct
gattttggtgacagtaactccttagatctctcagacatgggagtggtgagccggaactgc
acggaggatggctggtcggaacccttccctcattattttgatgcctgtgggtttgatgaa
tatgaatctgagactggggaccaggattattactacttgtcggtaaaggccctctacacg
gttggctacagcacgtccctcgtcaccctcaccactgccatggtcatcctgtgtcgcttc
cggaagctgcattgcacacgcaacttcatccacatgaacctgtttgtgtcattcatgctg
agggcgatctccgtcttcatcaaagactggattctgtatgcagagcaggacagcaaccac
tgcttcgtctccaccgtggaatgtaaggctgtcatggttttcttccactactgtgtcgtg
tccaactacttctggctgttcatcgagggcctgtacctcttcaccctgctggtggagacc
ttcttccctgaaaggagatacttctactggtacaccattattggctgggggaccccgact
gtgtgcgtgacggtgtgggctacactgagactctactttgatgacacaggctgctgggat
atgaatgacagcacagctctgtggtgggtgatcaaaggccctgtggttggctctatcatg
gttaactttgtgctttttattggcatcatcgttatccttgtgcagaaacttcagtctcca
gacatgggaggcaatgagtccagcatctacttcagctgcgtgcagaaatgctactgcaag
ccacagcgggctcagcagcactcttgcaagatgtcagaactgtccaccattactctgcgg
ctggcccggtccaccctgttgctcatcccactatttggaatccactacacggtattcgcc
ttctccccagagaatgtcagcaaaagggaaagactcgtgtttgagctggggctaggctcc
ttccagggctttgtggtggctgttctctactgttttctgaatggcgaggtacaagcggag
atcaagcgaaaatggcgaagctggaaggtgaaccgttacttcgctgtggacttcaagcac
cgacacccatctctggccagcagtggggtgaacgggggcacccagctctccatcctgagc
aagagcagctcccaaatccgcatgtctggtctccctgctgacaacctggccacctga

DBGET integrated database retrieval system