KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387208
Entry
100387208         CDS       T03264                                 

Gene name
KCNN3
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 3
  KO
K04944  potassium intermediate/small conductance calcium-activated channel subfamily N member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
cjc04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100387208 (KCNN3)
   04929 GnRH secretion
    100387208 (KCNN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100387208 (KCNN3)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100387208 (KCNN3)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 DHR10 IRK MbeD_MobD
Other DBs
NCBI-GeneID: 100387208
NCBI-ProteinID: XP_002760092
Ensembl: ENSCJAG00000009390
UniProt: F7I0V2
LinkDB
Position
18
AA seq 722 aa
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQPPPPPPAPPAAPQQPPGPSLQP
QPPQLQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGS
QLNLNDLLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPL
SRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAHNHQHAGTT
ASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLY
SKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLE
MLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLF
TDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQD
VTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELT
KAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIH
QLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTAS
FNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPVSDSPIGVSSTSFPTPYTSSS
SC
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggacacttctgggcacttccatgactcgggggtgggggacctggatgaagaccccaag
tgcccctgtccatcctctggggatgagcagcagcagcaacagcagcagcagcagccgccg
ccaccaccgccagcgccaccagcagccccccagcagcccccaggaccctcgctgcagcct
cagcctccgcagcttcagcagcagcagcagcagcagccaccgcatcccctgtctcagctc
gcccaactccagagccagcctgtccaccctggcctgctgcactcctctcccaccgctttc
agggcccccccttcgtccaactccaccgccatcctccacccttcctccaggcaaggcagc
cagctcaatctcaatgacctcttgcttggccactctccaagttccacagctacaagtggg
cctggtggaggcagccggcaccggcaggccagccccctggtgcaccggcgggacagcaac
cccttcacggagatcgccatgagctcctgcaagtatagcggtggggtcatgaagcccctc
agccgcctcagcgcctcccggaggaacctcatcgaggccgagactgagggccaacccctc
cagcttttcagccccagcaaccccccggagatcgtcatctcctcccgggaggacaaccat
gcccaccagaccctgctccatcaccctaatgcccacaaccaccagcatgccggcaccacc
gccagcagcaccaccttccccaaagccaacaagcggaaaaaccaaaacattggctataag
ctgggacacaggagggccctgtttgaaaagagaaagcgactgagtgactatgctctgatt
tttgggatgtttggaattgttgttatggtgatagagaccgagctctcttggggtttgtac
tcaaaggactccatgttttcgttggccctgaaatgccttatcagtctgtccaccatcatc
cttttgggcttgatcatcgcctaccacacacgtgaagtccagctcttcgtgattgacaat
ggcgcggatgactggcggatagccatgacctacgagcgcatcctctacatcagcctggag
atgctggtgtgtgccatccaccccattcctggcgagtacaagttcttctggacagcgcgc
ctggccttctcctacacaccctcccgggcggaggccgatgtggacatcatcctgtctatc
cctatgttcctgcgcctgtacctgatcgcccgagtcatgctgctgcacagcaagctcttc
actgatgcctcatcccgcagcatcggggccctcaacaagatcaacttcaacacccgcttc
gtcatgaagacgctcatgaccatctgccctggcactgtgctgctcgtgttcagtatctct
ttgtggatcattgctgcctggaccgtccgcgtctgtgaaaggtaccatgaccagcaggac
gtaactagtaattttctgggcgctatgtggctcatctccatcacattcctttccattggt
tatggagacatggtgccccacacatactgtgggaaaggtgtctgtctcctcactggcatc
atgggtgcaggctgcactgcccttgtggtggccgtggtggcccgaaagctggaactcacc
aaagcagagaagcacgttcacaacttcatgatggacacccagctcaccaagcggatcaag
aatgctgcagccaatgtccttcgggaaacatggttaatctacaaacacacaaagctgcta
aagaagattgaccatgccaaagtcaggaagcaccagaggaagttcctccaggctatccac
cagctgaggagcgtcaagatggagcagaggaagctcagcgaccaagccaacaccctggtg
gatctttccaagatgcagaatgtcatgtatgacttaatcacagaactcaatgaccggagc
gaagacctggagaagcagattggcagcctggagtccaagctggagcatctcaccgccagc
ttcaactccctgccgctgctcatcgccgacaccctgcgccagcagcagcagcagctcctg
tctgccatcatcgaggcccggggtgtcagcgtggcagtgggcaccacccacacccccgtc
tccgatagcccgattggggtcagctccacctccttcccgaccccatacacaagttcaagc
agttgctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391934
Entry
100391934         CDS       T03264                                 

Gene name
KCNN4
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 4
  KO
K04945  potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
cjc04929  GnRH secretion
cjc04970  Salivary secretion
cjc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100391934 (KCNN4)
   04929 GnRH secretion
    100391934 (KCNN4)
  09154 Digestive system
   04970 Salivary secretion
    100391934 (KCNN4)
   04974 Protein digestion and absorption
    100391934 (KCNN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100391934 (KCNN4)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100391934 (KCNN4)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 N-SET PMC2NT
Other DBs
NCBI-GeneID: 100391934
NCBI-ProteinID: XP_002762322
Ensembl: ENSCJAG00000013407
UniProt: F6PPT3
LinkDB
Position
22
AA seq 447 aa
MLRGGGPWAGSWLSPKTPGAMGGDLVLGLGALRRRKHLLEQEKSLAGWALALAGIGIGLM
VLHAEMLWFGGCSWALYLFLVKCIISISTFLLLCLILAFHAKEVQLFMTDNGLRDWRVAL
TGRQAAQILLELAVCGLHPAPVGGPPCAQGSGSPLTSLQPWPGFLSQGEALLSLAMLLRL
YLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTA
WVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTAL
LVAVVARKLEFNKAEKHVHNFMMDIQYAKEMKESAARVLQEAWRFYKHTRRKESRAARRH
QRRLLAAINAFRQVRLKHRKLREQVNSMVDISKMQMILYDLQLNLSSSHRALEKQIDTLS
GKLDTLTELLSTALGPRQLPEPSQETT
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgctgcgaggtgggggaccctgggcaggaagctggctgagccccaagaccccgggggcc
atgggcggggatctggtgcttggcctgggggccctgaggcgccgaaagcacttgctggag
caggagaagtctctggccggctgggcactggcgctggcgggaattggcatcggactcatg
gtgttgcatgcagagatgctgtggttcggggggtgctcgtgggcgctctacctgttcctg
gttaaatgcatcatcagcatttccaccttcttactcctctgcctcatcctggccttccac
gccaaagaggtccagctgttcatgaccgacaacgggctgcgggactggcgcgtggcgctg
accgggcggcaggcggcgcagatcctgctggagctggcggtgtgcgggctgcacccggcg
cctgtggggggcccgccgtgcgcgcagggttcagggtcgccgctgacctcgctgcagccc
tggccgggattcctgagccagggggaagcgctgctgtcgctggccatgctgctgcgcctc
tacctggtgccccgcgccgtgctcctgcgcagcggcgtcctgctcaacgcctcctaccgc
agcatcggcgctctcaaccaggtccgcttccgccactggttcgtggccaagctttacatg
aacacgcaccccggccgcctgctgctcggcctcacgctcggcctctggctgaccaccgcc
tgggtgctgtccgtggctgagaggcaggctgttaacgccaccgggcacctctccgacaca
ctgtggctgatccccatcacattcctgaccattggctatggtgacgtggtgccaggcacc
atgtggggcaagattgtctgcctctgcactggagtcatgggggtctgctgcacagcactg
ctggtggctgtggtggcccggaagctggagttcaacaaggcggagaagcatgtgcacaac
ttcatgatggatatccagtatgccaaagagatgaaggagtccgctgcccgagtgctgcaa
gaagcctggaggttctacaaacatactcgcaggaaggagtcccgagccgcccgcaggcat
cagcgcaggctgctggctgccatcaacgcgttccgccaggtgcggctgaaacacaggaag
ctccgggaacaagtgaactccatggtggacatctccaagatgcagatgatcctgtatgac
ctgcagctgaatctgagcagctcacaccgggccctagagaaacagattgacacgctgtcg
gggaagctagataccctgaccgagctgctcagcacagccttggggccgcggcagcttcca
gaacccagtcaggagaccacgtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394193
Entry
100394193         CDS       T03264                                 

Gene name
KCNMB2
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 2
  KO
K04938  potassium large conductance calcium-activated channel subfamily M beta member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100394193 (KCNMB2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100394193 (KCNMB2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100394193 (KCNMB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100394193 (KCNMB2)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100394193 (KCNMB2)
SSDB
Motif
Pfam: CaKB KcnmB2_inactiv AAA_8 tRNA-synt_1g
Other DBs
NCBI-GeneID: 100394193
NCBI-ProteinID: XP_008979483
Ensembl: ENSCJAG00000013410
UniProt: F6PZE6
LinkDB
Position
15
AA seq 235 aa
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWRLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERLQRINR
NT seq 708 nt   +upstreamnt  +downstreamnt
atgtttatatggaccagcggccggacgtcttcatcgtacagacatgacgagaaaagaaat
atttaccagaagatcagggaccatgacctcctggacaaaaggaaaacagtcacagccctg
aaggcaggagaggaccgagccattctcctgggactggccatgatggtatgctccatcatg
atgtactttctgctgggaatcacgctcctgcgctcatacatgcagagcgtgtggaccgaa
gagtctcaatgcaccttgctgaacgcgtccatcacagaaacatttaattgctccttcagc
tgcggtccagactgctggagactctctcagtacccctgcctccaggtgtacgtgaacctg
acttcttccggggaaaagctcctcctctaccacacagaagagacgataaaaatcaatcag
aagtgctcctatatacctaagtgtggaaaaaactttgaagaatccatgtccctggtgaat
gttgtcatggaaaacttcaggaagtaccaacacttctcctgctattctgacccagaagga
aaccagaagagcgttatcctaaccaaactctacagttccaacgtgctgttccattcactc
ttctggccgacctgcatgatggctgggggagtggcaattgtggccatggtgaaacttaca
cagtacctctccctgctctgtgagaggctccaacggatcaatagataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394787
Entry
100394787         CDS       T03264                                 

Gene name
KCNU1
Definition
(RefSeq) potassium calcium-activated channel subfamily U member 1
  KO
K05274  potassium large conductance calcium-activated channel subfamily M alpha member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100394787 (KCNU1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100394787 (KCNU1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100394787 (KCNU1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100394787 (KCNU1)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100394787 (KCNU1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 100394787
NCBI-ProteinID: XP_017819085
Ensembl: ENSCJAG00000002801
LinkDB
Position
13
AA seq 1157 aa
MFRLSSDLVRTKLKEENGKDVAKVSCETEIQLAFLLSSFLIFLSGLIILLIFRLIRGAVK
KWQIIRGTGIILELLTSGSIGKDPVRSLRFQGQFRDCIQMLLSAQTFVGQVLMILVFVLS
IGSLIIYLIKSTDPVRSCLSYEDKTIPIDLAFNAFFSFYFGLRFMAADDKIKFWLEMNSI
VDIFTIPPTFISYYLKSNWLGLRFLRALRLLELPQILQILQVTKTSDSVKFSKLLSVTLS
TWFTAAGVIHLVENSGDPWLEGRNSQTISYFESIYLVVITASTVGFGDVVPKTYLGRICM
MIFTLGSLILFANFMPEMVELFANKRKYTSSYKALKGNKFIVVCGNITVESVTAFLRNFL
QLKSGEINTEIVFLGETPPSLELETIFKCYLAYTTFISGSAVKQEDLRRVTVESAEACLI
IANPLCSDSHAEDISNIMRVLSIKNYFPTSRVIIQILQSHNKIYLPQIPSWNWNTGDNII
CFAELKLGFIAQGCLVPGLCTLLTSLFVEQNKKVSPKQTWRKDFLNGMKNKILTQRLSDD
FAGMSFPEVARLCFLKMHLLLIAIEYKSLFKDGFCGLILNPPEQVKIHRNTLGFFIAETP
KEVKRALFYCANCHNNVSIPELITNCGCKSRNRQHSVPSIKLAEHCIMGFSSRIAAQDSP
PREDAKTTNTPSITARTLLQEAEQDSDQLDSSGMFHWCKTTPLDSVILKRTDKLKHKFQN
HIVACVFGDAHSALVGLRNFVMPLRASNYTQQELKDIVFIGPLDYLQREWQFLQNFPRIY
ILPGSVLYPGDFHAANIEQCSMCVVLSPPSKSSSSQTLVDTEAIMATLIIRSLRTDSSSD
PSFAMPENTPSYTSGPNEKENCQRVPILTELKNPSNIHFIEQLGGLEGSLRKTNLHLSTA
FSTGAVFSGSFLDSLLATAFYNYHVLELLQMLVTGGISSQLEQHLDKDKVYDLSDSCTSL
LSGRKRCKLGLLSLHETILSDVKPRNTFEQLFCGSLDLFGILCVGLYRVIDEEDNNLENK
RGVFVITRPANDFNLLPSDLVFCAIPFSTACYKRNEETLLQKSXEIVNNAPQTTEKYSDT
NFPPTIVPGDETSYSPVYPYKSRSNSPFAKQTSWHQNRTHSVTSSSILSVENAKENGKQT
XDKEVYDGDSFAYSKPH
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgttcagactaagttcagatttagttcggactaagctaaaagaagaaaatgggaaagat
gtggcaaaagtttcctgtgaaactgagatccaattggcattccttctctcctccttttta
atcttcctcagtggactcatcatcctgttgatcttcaggctgatccgaggagctgttaaa
aaatggcaaatcatcagaggaacaggaattatcttggaactgctcacatcaggtagcatt
ggtaaggaccctgtaagaagcctccgcttccagggacaatttcgtgattgtatacaaatg
ttgctttcggcccagacctttgtagggcaagtgttgatgatccttgtctttgtactgagc
atcgggtctcttataatctatttaatcaaatctactgaccctgttagaagctgtttgtca
tatgaagacaaaaccatccctattgatttggctttcaatgctttcttcagtttctatttt
ggattgagatttatggcagctgatgacaagatcaagttctggctggagatgaattccatt
gtagacatctttactatcccaccaacctttatttcttattatttgaagagcaattggcta
ggtttaaggttcctaagagcattgcggctgctagaactccctcaaatcttgcaaattcta
caagtcaccaagaccagtgactcagtgaagttttccaaactgttgtcagtaactctcagt
acctggttcacagcagcaggagtcattcacctggtggaaaattctggtgatccctggctc
gaaggtagaaattcacagactatatcatattttgagtcaatttacctggtcgtgataaca
gcatcaactgttggctttggagatgtggtacccaagacatacttaggacggatctgcatg
atgatctttaccctggggagtttgatattatttgcaaactttatgcctgaaatggtggaa
ctgtttgccaataagaggaaatacaccagttcctataaagcactcaaaggaaacaagttc
attgtggtctgtggaaacatcactgtggaaagtgtgaccgctttcctgaggaatttcctc
caactcaagtcaggagaaatcaacaccgaaattgttttcctgggagagacccctccttct
ttggaacttgaaaccatatttaaatgctacttggcctacacaacattcatttctggatct
gcagtaaagcaggaggatctgaggcgtgttacggtggaatctgcagaggcatgcctgatc
atagccaaccctttgtgcagtgattcccatgctgaagatatttccaacattatgagggtg
ctctctatcaagaactatttccctaccagcagagtcatcatacaaatacttcaatcccat
aacaagatctatctgccacagattcccagctggaactggaacactggcgacaacatcatc
tgctttgctgaattaaagcttggattcatcgcccaaggctgtttggtgccaggcttgtgt
accctccttacatctctatttgtggagcaaaacaaaaaggtttctcccaaacagacctgg
cggaaagatttcttgaatggcatgaagaacaaaattctgacccaacgtctttctgatgac
tttgctggaatgagttttcctgaagttgccaggctctgctttctgaagatgcacctcctg
ttgatagccattgaatacaagtccctcttcaaagatggtttctgtggtctgatactaaat
ccacctgaacaagttaagatacataggaacacattagggttctttattgctgaaactcca
aaggaagtcaaaagagccttgttttactgtgcgaactgtcacaataatgtgtctattcct
gagctaattacaaactgtggctgcaaaagcagaaaccgacagcactcagtgccatcgata
aagttagcggaacattgcatcatgggattctcctctcgtatagcagcacaggattctcct
ccaagggaagatgcaaaaactacgaacacaccaagcatcactgccaggacccttctacaa
gaagcagaacaagattctgaccagctggatagcagtggcatgtttcactggtgcaaaaca
acccctttggacagcgtgattctgaaacgaactgacaagttgaaacacaagtttcagaac
cacattgtagcatgtgtatttggagacgctcattcagccctggtggggcttcggaacttt
gtaatgcccttgagagccagcaactacacccagcaggagctgaaggacatagtgttcatt
gggcctctggactatctacagagagaatggcaatttctccagaattttccccggatatat
attctgcctggatccgtactttatcctggagacttccacgcggccaacatagagcaatgt
tccatgtgcgttgtcttgtcccctccatccaagtcatcaagcagccagactctggtagac
acggaagcgatcatggcaaccctcatcatcagatccttgcgaactgactcctcctccgac
ccgtcatttgcaatgccagagaatactccaagttacacaagtggaccaaatgagaaagaa
aactgccaaagagtccctatcctcactgaattgaaaaatccttccaacattcactttatt
gaacagcttggtggactggaagggtctctccgaaaaacaaacctgcatctcagcactgcc
ttttctacaggtgctgttttttccggcagcttcttggattctctcctggccacggccttc
tacaattatcatgtcctggaattgcttcagatgctggtgacgggaggaatcagttctcag
ctggaacagcatttagataaggacaaggtctacgacctgtcagatagctgcacgtcgctc
ttgtctggcagaaagcggtgtaagctggggcttctgtctttacatgaaaccattttgtca
gacgtcaaaccaagaaacacctttgaacaactgttctgtgggtcgttagatctttttgga
atcctgtgtgttggcttatacagagtaatagatgaagaggacaacaacctggaaaacaaa
aggggagtgtttgtgatcacccggccagccaatgacttcaacttgctgccctcagatctt
gtgttttgtgccatacccttcagcactgcttgttacaaaaggaatgaagagactttactg
caaaagtcanatgaaattgtaaataatgcaccacagacaacagagaaatattcagacaca
aattttcctcctaccattgttccaggtgatgagacatcgtattcacctgtctatccttac
aagtctagaagtaactctccttttgctaagcaaacatcttggcatcagaatagaacacac
agtgttacatcatcctcaatactttcagttgaaaatgcaaaagaaaatggaaagcaaacc
tgagacaaggaggtttatgatggggactcttttgcatattcaaagccacactag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395410
Entry
100395410         CDS       T03264                                 

Gene name
KCNMB1
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100395410 (KCNMB1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100395410 (KCNMB1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100395410 (KCNMB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100395410 (KCNMB1)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100395410 (KCNMB1)
SSDB
Motif
Pfam: CaKB DUF2119
Other DBs
NCBI-GeneID: 100395410
NCBI-ProteinID: XP_002744624
Ensembl: ENSCJAG00000011690
UniProt: F6R0K0
LinkDB
Position
2
AA seq 191 aa
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSIWTEESMCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTPDQNQQCSYIPDNLDNYPTARADV
EKVRARFQEKRVFYCFSTTLVNETSVLYRRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggtgaagaagctggtaatggcccagaagcggggagagacacgagccctttgcctgggc
gtcaccatggtggtgtgtgccgtcatcacttactacatcctggtcacgactgtgctgccc
ctctaccagaaaagcatatggaccgaggaatccatgtgccacctgattgagaccaacatc
agggaccaggaagagctgaagggcaagaaggtgccccagtacccgtgcctgtgggtcaac
gtgtcagctgcaggcaggtgggctgtgctgtaccacacggaggacactccggaccagaac
cagcagtgctcctacatcccagacaacctggacaactacccgacagcccgggccgatgtg
gagaaggtcagagccagattccaagagaagcgggtcttctactgcttctcaacaactctg
gtgaacgagaccagcgtcctgtaccggcgcctctatgggccccaggccctcctcttctcc
ctcttctggcccaccttcctgctgaccggtggcctcctcattatcgccatggtgaagagc
aaccagtacctgtccatcctggcagcccagaagtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398217
Entry
100398217         CDS       T03264                                 

Gene name
KCNN1
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 1
  KO
K04942  potassium intermediate/small conductance calcium-activated channel subfamily N member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
cjc04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100398217 (KCNN1)
   04929 GnRH secretion
    100398217 (KCNN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100398217 (KCNN1)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100398217 (KCNN1)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Seryl_tRNA_N DALR_1 Laminin_II IRK
Other DBs
NCBI-GeneID: 100398217
NCBI-ProteinID: XP_017823457
Ensembl: ENSCJAG00000014026
LinkDB
Position
22
AA seq 543 aa
MNSHSYNGGVGRPLGSGPGALGREPPDPEAGCPPQPPHSPGLQVVVAKSEPAVPSPGSRR
GQPQDQDDEEDDEEDEAGGRRGSGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGVVV
MVTETELSWSVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDNQEVTINFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQSRV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQSVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPPDQAARSSPCRWPPVATS
DCG
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaacagccacagctacaatggcggcgtggggcggcctctgggcagtgggccaggcgcc
ctgggacgagaacctccggaccccgaggctggctgtcccccgcagcccccgcacagcccg
ggcctccaggtggtggtggccaagagtgagccagccgtgccctcgcccggcagccgccgg
gggcagccccaggaccaggatgatgaggaggatgatgaggaagatgaggctggcgggcgg
aggggctcggggaagccctcaaacgtgggccaccgcctgggccaccggcgggcactcttt
gagaagcggaagcgcctcagtgactatgccctcattttcggcatgtttggcgtcgtcgtc
atggtgacggagactgagctgtcctggagcgtatataccaaggagtctctgtactcattc
gcgctcaaatgcctcatcagcctctccacggcgatcctgctgggtctcgttgtcctctac
cacgcccgggagatccagctgttcatggtggacaacggggcggatgactggcgcatcgcc
atgacctgcgagcgcgtgttcctcatctcgctggagctggcggtgtgcgccattcacccg
gtgcccggccactaccgcttcacatggacagcgcggctggccttcacgtacgcgccctcg
gtggccgaggccgacgtggatgtgctgctgtccatccccatgttcctgcgcctctacctg
ctgggccgggtgatgcttctgcacagcaagatcttcacggacgcttcgagccgcagcatc
ggggccctcaacaagatcaccttcaacacgcgcttcgtcatgaagacgctcatgaccatc
tgccccggcacggtgctgctggtcttcagcatctcctcctggatcatcgcagcctggacc
gtgcgcgtctgcgagaggtaccacgacaatcaggaagtgaccattaacttcctgggtgcc
atgtggctgatttccatcaccttcctctccatcggttatggtgacatggtgccccacacc
tactgcgggaagggcgtgtgcctgctcacaggcatcatgggagctggctgcacggcactc
gtggtggctgtggtggcccggaagctggagctcaccaaggctgagaagcacgtgcataac
ttcatgatggacactcagctcaccaagcgggtgaaaaacgccgctgctaacgttctcagg
gagacgtggctcatctacaaacataccaggctggtgaagaagccagaccaatcccgggtt
cggaaacaccagcgtaagttcctccaagccatccatcaggctcagaagctccggagcgtg
aagattgagcaagggaagctgaacgaccaggctaacacgctcacagacctggccaagacc
cagagcgtcatgtacgaccttgtatcggagctgcacgcgcagcatgaggagctggaggct
cgcctggccaccctggaaagccgcctggatgccctgggcgcctctctgcaggccctgccc
ggcctcatcgcccaagccatacgcccgcccccgccgcccctgcctccccggcccggcccc
ggccccccagaccaggcggcccggagctccccatgccggtggcctcccgtggccacctcg
gactgcgggtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402638
Entry
100402638         CDS       T03264                                 

Gene name
KCNMA1
Definition
(RefSeq) potassium calcium-activated channel subfamily M alpha 1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04911  Insulin secretion
cjc04924  Renin secretion
cjc04970  Salivary secretion
cjc04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100402638 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100402638 (KCNMA1)
   04924 Renin secretion
    100402638 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100402638 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    100402638 (KCNMA1)
   04972 Pancreatic secretion
    100402638 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100402638 (KCNMA1)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100402638 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 100402638
NCBI-ProteinID: XP_017834464
Ensembl: ENSCJAG00000001073
LinkDB
Position
12
AA seq 1316 aa
MANGGGGGGGNSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSVHEP
KMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGK
TKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLV
FALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWL
EVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLL
SIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTL
GRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNF
LKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESA
DACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKE
GDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTE
YLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLG
FFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERD
CSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPN
TSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKDIEKVILTRSEAAMTVLSG
HVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVS
ILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIG
VLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELAKPGKLPLVSVNQEK
NSGTHILMITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFN
DNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL
GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF
CLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTANRQNRPKSRESRDKQNATRM
NRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC
NT seq 3951 nt   +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcggcaacagcggcggcggcggcggcggcggaggc
agcagtcttagaatgagtagcaatatccacgcgaaccatctcagcctagacgcgtcctcc
tcctcctcttcctcttcttcttcctcctcctcttcctcctcgtcctcggtccacgagccc
aagatggatgcgctcatcatcccggtgaccatggaggtgccgtgcgacagccggggccaa
cgcatgtggtgggctttcctagcctcctccatggtgactttcttcgggggccttttcatc
atcttgctctggcggacgctcaagtacctgtggaccgtgtgctgccactgcgggggcaag
acgaaggaagcccagaagattaacaatggctcaagccaggcggatggcactctcaaacca
gtggatgaaaaagaggaggcagtggccgccgaggtcggctggatgacctctgtgaaggac
tgggcgggggtgatgatatccgcccagacactgactggcagagtcctggttgtcttagtc
tttgctctcagcatcggtgcacttgtaatatacttcatagattcgtcaaacccaatagaa
tcctgccagaatttctacaaagatttcacattacagatcgacatggctttcaacgtgttc
ttccttctctactttggtttgcggtttattgcagccaatgataagctgtggttctggctg
gaagtgaattctgtagtggatttcttcacagtgccccccgtgtttgtgtctgtgtactta
aacagaagttggcttggtttgagatttttaagagctctgagactgatacagttttcagaa
attttgcagtttctgaatattcttaaaacaagtaattccatcaagctggtgaatctgctc
tccatatttatcagcacatggctgactgcagctggattcatccatttggtggagaattca
ggggacccatgggaaaatttccaaaacaaccaggctctcacctactgggaatgtgtctat
ttactcatggttacaatgtccaccgttggctatggggatgtttatgcaaaaaccacgctt
ggccgcctcttcatggtcttcttcatcctcgggggactggccatgtttgccagctacgtc
cctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcctatagtgcggtt
agtggaagaaagcacattgtggtttgcggacacatcactctggagagtgtttccaacttc
ctgaaggactttctgcacaaggaccgggacgatgtcaatgtggagatcgtttttcttcac
aacatctcccccaacctggagcttgaagctctgttcaaacgacattttactcaggtggaa
ttttatcagggttcggtcctcaatccacatgaccttgcaagagtcaagatagagtcagca
gatgcgtgcctgatccttgccaacaaatactgcgctgacccggatgcggaggacgcctcg
aacatcatgagagtaatctccataaagaactaccatccgaagataagaatcatcactcaa
atgctgcagtatcacaacaaggcccatctgctaaacatcccgagctggaattggaaggaa
ggtgatgatgcaatctgcctcgcagagctgaagttgggcttcatagcccagagctgcctg
gctcaaggcctctccaccatgcttgccaacctcttctctatgaggtcattcataaagatt
gaggaagacacgtggcagaaatactacttggaaggagtctcaaatgaaatgtacacagaa
tatctctccagtgccttcgtgggtctgtccttccctactgtttgtgagctgtgttttgtg
aagctcaagctcctaatgatagccattgaatacaagtctgccaaccgagagagccgaagc
cgaaagcgtatattaattaatcctggaaatcatcttaagatccaagaaggtactttagga
tttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttactgcaaggcctgt
catgatgacatcacagatcccaaaagaataaaaaaatgtggctgcaaacggcccaagatg
tccatctacaagagaatgagacgggcatgttgttttgattgcggacgttctgagcgtgac
tgctcgtgcatgtcaggccgtgtgcgtggtaacgtggacacccttgagagagccttccca
ctttcttctgtctctgttaatgattgctccaccagtttccgtgcctttgaagatgaacag
ccgtcaacactatcaccaaaaaaaaagcaacggaacggaggtatgcggaactcacccaac
acctcgcctaagctgatgaggcatgaccccttgttaattcctggcaatgatcagattgac
aacatggactccaatgtgaagaagtacgactctactgggatgtttcactggtgtgcgccc
aaggatatagagaaagtcatcctgactcgaagtgaggccgccatgaccgtcctgagtggc
catgtcgtggtctgtatctttggtgatgtcagctcagccctaatcggcctccggaacctg
gtgatgccgcttcgtgccagcaactttcattaccacgagctcaagcacattgtgtttgtg
ggctctattgagtacctcaagcgggaatgggagacgcttcataacttccccaaagtgtcc
atattgcctggtacgccattaagtcgggctgatttaagggctgtcaacatcaacctctgt
gacatgtgcgttatcctgtcagccaatcagaataatattgatgatacttcgctgcaggac
aaggaatgcatcttggcgtcgctcaacatcaaatctatgcagtttgatgacagcatcggg
gtcttgcaggctaattcccaagggttcacacctccaggaatggatagatcctctccagat
aacagcccagtacacgggatgttacgtcaaccgtccatcacaactggggtcaacatcccc
atcatcactgaactagctaaaccgggcaagttgcctttggtttcagtcaatcaggaaaaa
aacagtgggacgcacattctaatgataactgaactggtgaatgatactaatgttcagttt
ttggaccaagacgatgatgatgaccctgacacagaactgtacctcacacagccctttgcc
tgtgggacagcgtttgccgtcagtgtcctggactcgctcatgagcgcgacatacttcaat
gacaatatcctcaccctgatacggaccctggtgaccggaggagccacgccggagctagag
gctctgattgctgaggagaatgcccttcgaggtggctacagcaccccgcagacactggcc
aatagggaccgctgccgtgtggcccagttagctctgcttgatgggccatttgcggattta
ggggatggtggttgttatggtgatctgttctgcaaagctctgaaaacatataatatgctt
tgttttggaatttaccggctgagagatgcccacctcagcacccccagtcagtgcacaaag
aggtatgtcatcaccaaccccccctacgagtttgagctcgtgccgacggacctgatcttc
tgcttaatgcagtttgaccacaacgccggccagtcccgggccagcctgtcccattcctcc
cactcctcgcagtcctccagcaagaagagctcctctgttcactccatcccgtccacagca
aaccgacagaaccggcccaagtccagggagtcccgggacaaacagaatgcaacaaggatg
aatagaatgggccaagcagaaaagaaatggtttacagatgaaccggataatgcctatccc
agaaacattcaaatcaagcccatgagtacccacatggctaaccagatcaaccaatataaa
tccacaagcagcttgattccaccaatcagagaagttgaagatgaatgttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403137
Entry
100403137         CDS       T03264                                 

Gene name
KCNMB3
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 3
  KO
K04939  potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100403137 (KCNMB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100403137 (KCNMB3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100403137 (KCNMB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100403137 (KCNMB3)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100403137 (KCNMB3)
SSDB
Motif
Pfam: CaKB
Other DBs
NCBI-GeneID: 100403137
NCBI-ProteinID: XP_017820187
LinkDB
Position
15
AA seq 291 aa
MDFSPSSELGSHFVAFILLTTHRTAFPASGKKRETDYSDGDPLDVHKRPPSSAGEDRAML
LGFAMMGFSVLMFFLLGTTILXHFFFPNXSTQREESTCTAIHTAITDDWLDCAFTCRVHC
RGQGKYPCLQVFVNLTHSGQRALLHYNEEAVQVNPKCLYTPKCHQDRNDLLSSALDIKAF
FDHKNGTAFSCFYSPGSQADXVLIKQYDQMAIFHCFLWPSLTLLGGALIVGMVRLTQHLS
SLCEKYRDEVGGKVPYTEQHQFRLXSVRRSRNLQTVAELKGWLSDVRDFCS
NT seq 876 nt   +upstreamnt  +downstreamnt
atggacttttcaccgagctctgaactgggatctcattttgttgcattcatcctgctcacg
acacacaggacagcctttcctgcctcagggaagaagagagagacagactacagtgatgga
gacccactcgacgtgcacaaaaggccgccgtccagtgctggcgaggaccgggccatgctg
ctgggctttgccatgatgggcttctcagtcctcatgttcttcttgcttggaacaaccatt
ctataacattttttttttccaaattgaagcactcagagagaagaatcgacctgcactgcc
atccacacagctatcacggacgactggctggactgtgccttcacctgtcgtgtgcactgc
cgtggtcaggggaagtacccgtgccttcaggtgtttgtgaacctcacccattcagggcag
agagctctcctacattataatgaagaggctgtccaggtaaatcccaagtgcctttacaca
cctaagtgccaccaagatagaaatgatttgctcagcagtgctctggacataaaagcattc
tttgatcataagaatggaaccgccttttcatgcttctacagtccgggcagccaagccgac
nntgttcttataaaacagtatgaccaaatggccatcttccactgcttcttgtggccttcg
ctgaccctgctaggtggtgccctgattgttggcatggtgagattaacacaacacctgtcc
tcactgtgtgaaaaatatagagatgaggtaggtggaaaagtaccttatacagaacagcat
cagttcagactgtgaagtgtgaggaggagcagaaatcttcagacggtggccgaattaaag
ggctggctttcagatgttcgtgatttctgcagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413033
Entry
100413033         CDS       T03264                                 

Gene name
KCNN2
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 2
  KO
K04943  potassium intermediate/small conductance calcium-activated channel subfamily N member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04726  Serotonergic synapse
cjc04911  Insulin secretion
cjc04929  GnRH secretion
cjc04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100413033 (KCNN2)
   04929 GnRH secretion
    100413033 (KCNN2)
  09154 Digestive system
   04976 Bile secretion
    100413033 (KCNN2)
  09156 Nervous system
   04726 Serotonergic synapse
    100413033 (KCNN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100413033 (KCNN2)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100413033 (KCNN2)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Med9 IRK
Other DBs
NCBI-GeneID: 100413033
NCBI-ProteinID: XP_017825224
LinkDB
Position
2
AA seq 849 aa
MFRRRRKCDVMPIVLVRPTNRTRRLDSTGAGMGPSSHQQQESPLPTITHCAGCTTAWSPC
SFNSPDMETPLQFQRGFFPEQQPPPPRSSHLHCQQQQQSQDKPCPPFAPLPHPHHLAHQQ
PASGGSSPCLRCNSCASSGAPAAGAGDNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCCC
SSRRGSQLNVSELTPSSHASALRQQYAQQPASTSQYHQCHSLQPAASPTGSLGSLGSGPP
LSHHHHHPHPAHHQHHQPQARRESNPFTEIAMSSCRYNGGVMRPLSNLSASRRNLHEMDS
EAQPLQPPASVGGGGGASSPSAAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGG
GGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIET
ELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYER
IFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVM
LLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACE
RYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVV
ARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQR
KFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTL
ETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMEGYDKHVTYNTERSRSSSRRRRSSST
APPTSSESS
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgttccggagaaggcgcaaatgtgatgtcatgcccattgttttggtgcgcccaaccaat
cggactcgccgcctggattctaccggagccggcatgggcccttcctcgcaccagcagcag
gagtccccgctcccgaccataacgcattgcgcagggtgcaccaccgcttggtctccctgc
agctttaacagccctgacatggaaaccccattgcagttccagcgcggcttcttcccagag
cagcagccgccgccgccgcgctcctcacacctgcattgccagcagcagcaacagagccag
gacaagccgtgcccgcccttcgcgcccctcccgcaccctcaccacctcgcgcaccagcag
ccggccagcggcggcagcagcccatgcctccggtgcaacagctgcgcctcctccggtgcc
ccggcggcgggggcgggggataacctgtccctgctgctccgcacctcctcgcccggcggc
gccttccggacccgcacctcctcgccgctgtcgggctcgtcgtgttgctgctgctgctgc
tcgtcgcgccggggcagccagctcaatgtgagcgagctgacgccgtccagccatgccagt
gcgctccggcagcagtacgcgcagcagcccgcgtccacctcccagtaccaccagtgccac
agcctgcagcccgccgccagccctacgggcagcctcggcagcctgggctccgggcccccg
ctctcgcaccaccaccaccacccgcacccggcgcaccaccagcaccaccagccccaggcg
cgccgcgagagcaaccccttcaccgaaatagccatgagcagctgcaggtacaacgggggc
gtcatgcggccgctcagcaacttgagcgcgtcccgccggaacctgcacgagatggactca
gaggcgcagcccctgcagccccccgcgtccgtcggaggaggtggcggcgcgtcctccccg
tctgcagccgccgccgcttcgtcctcagctcccgagatcgtggtgtcgaagcccgagcac
aacaattccaacaacctggcgctctatggaaccggcggcggaggcagcactggaggaggc
ggcggcggtggcgggagcgggcacggcagcagcagtggcaccaagtccagcaaaaagaaa
aaccagaacatcggctataagctgggccaccggcgcgccctgttcgaaaagcgcaagcgg
ctcagcgactacgcgctcatcttcggcatgttcggcatcgtggttatggtcatcgagacc
gagctgtcatggggcgcttacgacaaggcgtcgctgtattccttagctctgaaatgcctt
atcagtctctccacgatcatcctgctcggtctgatcatcgtgtaccacgccagggaaata
cagttgttcatggtggacaatggagcagatgactggagaatagccatgacttatgagcgt
attttcttcatctgcttggaaatactggtgtgtgctattcatcccatacctgggaattat
acgttcacatggacggcccggcttgccttctcctatgccccatccacaaccaccgctgat
gtggatattattttatctataccaatgttcttaagactctatctgattgccagagtcatg
cttttacatagcaaacttttcactgatgcctcctctagaagcattggagcacttaataag
ataaacttcaatacgcgttttgttatgaagactttaatgactatatgcccaggaactgta
ctcttggtttttagtatctcattatggataattgccgcatggactgtccgagcttgtgaa
aggtaccatgatcaacaggatgttactagcaacttccttggagcgatgtggttgatatca
ataactttcctctccattggttatggtgacatggtacctaacacatactgcggaaaagga
gtctgcttgcttactggaattatgggtgctggttgcacagccctggtggtagctgtagtg
gcaaggaagctagaacttaccaaagcagaaaaacacgtgcacaatttcatgatggatact
cagctgactaaaagagtaaaaaatgcagctgccaatgtactcagggaaacatggctaatt
tacaaaaatacaaagctagtaaaaaagatagatcatgcaaaagtaagaaaacatcaacga
aaattcttgcaagctattcatcaagctcggaaattaagaagtgtaaaaatggagcagagg
aagctgaatgaccaagcaaacaccttggtggacctggcaaagacccagaatatcatgtat
gacatgatttctgacttaaacgaaaggagtgaagacttcgagaagaggattgttaccctg
gaaacaaaattagagactttgattggtagcatccacgccctccctgggctcataagccag
accatcaggcagcagcaaagagatttcattgaggctcagatggagggctacgacaagcat
gtcacttacaacactgaacggtcccggtcctcgtccaggaggcggcggtcctcctccaca
gcgccaccaacttcatcagagagtagctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413100
Entry
100413100         CDS       T03264                                 

Gene name
KCNMB4
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 4
  KO
K04941  potassium large conductance calcium-activated channel subfamily M beta member 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100413100 (KCNMB4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100413100 (KCNMB4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100413100 (KCNMB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100413100 (KCNMB4)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   100413100 (KCNMB4)
SSDB
Motif
Pfam: CaKB LapA_dom
Other DBs
NCBI-GeneID: 100413100
NCBI-ProteinID: XP_009002459
Ensembl: ENSCJAG00000001563
LinkDB
Position
9
AA seq 210 aa
MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQNLQATAANCTVLSVQ
QIGEVFECTFTWGADCSGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
RENQKNLESVMNWQQYWKDEIGSQPFICYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVT
FVVGVLIVVLTICAKSLAVKAEAMKKRKFS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgaagctccgggtggcttacgagtacacggaagccgaggacaagagcatccggctc
ggcttgtttctcatcatctccggcgtcgtgtcgctcttcatcttcggcttctgctggctc
agtcccgcgctgcagaatctgcaagccacggcggccaactgcacggtgctgtcggtgcag
cagatcggcgaggtgttcgagtgcaccttcacctggggcgcagactgcagtggcacctcg
cagtatccctgcgtccaggtgtacgtgaacaactccgagtccaactccagggcgctgctg
cacagcgacgagcaccagctcctgaccaaccccaagtgctcctatatccctccctgtaag
agagagaatcagaagaatttggaaagtgtcatgaattggcaacagtactggaaagatgag
attggttcccagccatttatttgctattttaatcaacatcaaagaccagacgacgtgctt
ctgcatcgcactcatgatgagattgtcctcctgcattgcttcctctggcccctggtgaca
tttgtcgtgggcgttctcattgtggtcctgactatctgtgccaagagcttggcggtcaag
gcggaagccatgaagaagcgcaagttctcttaa

DBGET integrated database retrieval system