KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387233
Entry
100387233         CDS       T03264                                 

Gene name
MB21D1
Definition
(RefSeq) Mab-21 domain containing 1
  KO
K17834  cyclic GMP-AMP synthase [EC:2.7.7.86]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05163  Human cytomegalovirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100387233 (MB21D1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100387233 (MB21D1)
   05171 Coronavirus disease - COVID-19
    100387233 (MB21D1)
   05168 Herpes simplex virus 1 infection
    100387233 (MB21D1)
   05163 Human cytomegalovirus infection
    100387233 (MB21D1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.86  cyclic GMP-AMP synthase
     100387233 (MB21D1)
SSDB
Motif
Pfam: Mab-21 SLD3
Other DBs
NCBI-GeneID: 100387233
NCBI-ProteinID: XP_008992910
Ensembl: ENSCJAG00000009988
LinkDB
Position
4
AA seq 548 aa
MQPRRGKATRRASQARATAPEASAPSARGARTDPNQSLAAPEAARPHAGKFGPARGSGSR
QKKNAQDTQERPPARELGARPKKVPQRAEDARLSDAISASGAEAGEPPEAPEPAFSRAGS
RRPTGARCSAEPRPPPGPRDLPSPGLPVSGPILGRRESAPRTRKLRAVLEKLRLSRDDVS
NAAKVVNSVVDHLLGRLQQCESEFKGKFKVESLHTGSYYERVKISTPNEFDVMFKLELPR
IQLEEYSNTGAYYFVKFKRNLKENPLRQFLEDEILSASKMLSKFRKIIKEEIKNMQADTD
VIMERKRRGSPAVTLLIRKEISVDIILALESKSSWPASTQKGLPIKNWLSAKVRTKLRRE
PFYLVPKHAKEGNSFQEETWRLSFSHIEKEILRDHGQSKTCCEEKGVKCCRKDCLKLMKY
LLERLKEKFKSGKHMDKFCSYHVKTAFFHVCTENPQDSQWDPKDLELCFDNCLTYFLQCL
RTEKLEHYFIPAFNLFSSNLIDKKSKEFLSKQIEHERNNEFPVFGEFRDSMFRKNLSDSQ
SWRIPKKF
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgcagcctcgacgcggaaaggccacgcggagagcttcccaggcccgagccaccgctccc
gaggcttctgcgccaagcgccaggggcgcccggacggacccaaaccagtctctggctgct
ccggaggccgcccggccccacgcgggaaagttcggccccgccagggggtcgggatccagg
cagaagaagaacgcccaggacacccaggaaaggccgccagcccgtgagctgggggcccgc
cccaagaaggtccctcagcgcgccgaggacgcgcggctctcggacgccatcagcgcctct
ggggcggaggcgggagagcctcccgaggctcccgagccggctttttccagagctggttct
cgccgcccgacgggtgcgcgctgctctgcggagcccagacccccgcccgggccccgggac
ttgcccagccccggcctgccggtctccggccccatcctcggccgaagggagtcggcgccg
cggaccaggaagctccgggcggttttagagaagttaaggctaagtcgcgacgatgtctcc
aacgcggccaaggtggtgaacagcgttgtggaccacctgctgggcagactgcagcagtgc
gagtccgagttcaaaggcaagttcaaagtggagtcgctgcacaccgggagctactatgag
cgcgtgaagatttctacacctaatgaatttgatgtcatgtttaaactggaactccccaga
attcaactagaagaatattccaacactggtgcatattactttgtgaaattcaaaagaaat
ctgaaagaaaatcctctgagacaatttttagaagatgaaatattatcagcttctaagatg
ctgtctaagtttaggaaaatcattaaggaagaaattaaaaacatgcaagcagatacagat
gtcatcatggagaggaaaagaagagggagccctgctgtaacacttcttattagaaaagaa
atatctgtggatataatcctggctttggaatcaaaaagtagctggcctgctagcacccag
aaaggcctgcccatcaaaaactggctttcagcgaaagttaggacgaagctaagacgagag
ccattttaccttgtacccaagcatgcaaaggaaggaaatagtttccaagaagaaacatgg
cggctatccttctctcacattgaaaaggaaattttgagggatcatggacaatctaaaacg
tgttgtgaagagaaaggagtgaaatgttgcaggaaagattgtttaaaactgatgaaatac
cttttagaacggctgaaagaaaagtttaaaagtggaaaacatatggataaattctgttct
tatcatgtgaaaactgctttctttcacgtatgtaccgagaaccctcaagacagtcagtgg
gaccccaaagatctggagctctgctttgataactgcctgacatactttcttcagtgcctc
aggacagaaaaacttgaacattatttcattcctgcattcaatctattctctagcaactta
attgacaaaaaaagtaaagaatttctgtcaaagcaaattgaacatgaaagaaacaatgag
tttccagtttttggtgaatttcgagattctatgtttagaaaaaatttgagtgactctcag
tcctggagaataccaaaaaaattttaa

DBGET integrated database retrieval system