KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387417
Entry
100387417         CDS       T03264                                 

Gene name
NRG3
Definition
(RefSeq) neuregulin 3
  KO
K05457  neuregulin 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100387417 (NRG3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100387417 (NRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100387417 (NRG3)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100387417 (NRG3)
SSDB
Motif
Pfam: EGF Laminin_EGF LapA_dom EGF_2
Other DBs
NCBI-GeneID: 100387417
NCBI-ProteinID: XP_009007876
LinkDB
Position
12
AA seq 695 aa
MSEGAAAASPPGAASAAAASVEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
STTARNTAAPPTVLSTTAAFFSSSTPGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTP
SWTLSPFQDAASSSSSSSSPSTTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPNHLGIEFMESEEVYQRQV
LSISCIVFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLVK
SHVQLQNYSKVERNPVTALEKMMESSFVGPQTFPEVPSPDRGRQSVKQHRSLSSCCSPGQ
RSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTVPCQGYSSDGLKTQRNTS
INMQLPSRETSPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCMQMPGISEVKSIKWC
KNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYELASVETEDSA
SENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgagtgaaggggcggccgctgcctcgccacctggtgccgcttcggcagccgccgcctcg
gttgaggagggcaccgcggcggctgcggcggcggcagcggcgggcgggggcccggacggc
ggcggcgaaggggcggccgagcccccccgggagttacgctgtagcgactgcatcgtgtgg
aaccggcagcagacttggctgtgcgtggtgcctctgttcatcggcttcatcggcctgggg
ctcagcctcatgcttctcaaatggatcgtggtgggctccgtcaaggagtacgtgcccacc
gacctggtggactccaaggggatgggccaggaccccttcttcctctccaagcccagctct
ttccccaaggccatggagaccaccaccacgaccacttccaccacgtcccccgccaccccc
tccgccgggggcgctgcctcctccaggacgcccaaccggattagcacccggctgaccacc
atcactcgggcgcccactcgcttccccgggcaccgggtgcccatccgggccagcccgcgc
tctaccacagcacggaacactgcggcccccccgacggtcctatctaccacggccgcgttc
ttcagtagcagtacgccgggctctcgacccccggtgccaggaactccaagcacccaggca
atgccctcctggcccactgcggcatacgctacctcctcctaccttcacgattctactccc
tcctggaccctgtctccctttcaggatgctgcctcgtcttcttcctcctcttcctcgccc
tctaccaccacgacaccagaaactagcaccagccccaaatttcatacgacgacatattcc
acagagcgatctgagcacttcaaaccctgccgagacaaggaccttgcatactgtctcaat
gatggcgagtgctttgtgatcgaaaccctgactggatcgcataaacactgtcggtgcaaa
gaaggctaccaaggagtccgttgtgatcaatttctgccgaaaactgattccatcttatcg
gatccaaaccacttgggaattgaattcatggagagtgaagaagtttatcaaaggcaggtg
ctgtccatttcatgtatcgtctttggaattgtcatcgtgggcatgttctgtgcagcattc
tacttcaaaagcaagaaacaagctaaacaaatccaagagcagctgaaagtgccgcaaaat
ggtaaaagctacagtctcaaagcatccagcacaatggcgaagtcagagaacttggtgaag
agtcatgtccagctgcaaaattattcaaaggtggaaaggaatccagtgactgcattggag
aaaatgatggagtcaagttttgtcggcccccagacattccctgaggttccttctcctgat
agaggacgccaatctgtcaaacagcacaggagtctatcctcttgctgcagcccagggcaa
aggagtggcatgctccataggaatgccttcagaaggacacccccatcacctcgaagtagg
ctaggtggaattgtgggaccggcatatcaacaactggaagaatcaaggatcccagaccag
gatacagtaccttgccaagggtattcatccgatggtttaaaaacccaacgaaatacatca
ataaatatgcaactgccttcaagagagacaagcccctattttaatagcttggagcaaaag
gacctggtgggctattcatccacaagggccagttctgtgcccatcatcccttcagtgggt
ctagaggaaacctgcatgcaaatgccagggatttccgaagtcaaaagcatcaaatggtgc
aaaaactcctattcagctgacgttgtcaatgtgagtattccagtcagcgattgtcttata
gcagaacaacaagaagtgaaaatattgctagaaactgtccaggagcagatccgaattctg
actgatgccagacggtcagaagactacgaactggccagcgtagaaaccgaggacagtgca
agcgaaaacacagcctttctccccctgagtcccacggccaaatcagaacgagaggcacaa
tttgtcttaagaaatgaaatacaaagagactctgcattgaccaagtga

DBGET integrated database retrieval system