KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387579
Entry
100387579         CDS       T03264                                 

Gene name
BTC
Definition
(RefSeq) betacellulin
  KO
K09783  betacellulin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100387579 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100387579 (BTC)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100387579 (BTC)
SSDB
Motif
Pfam: Shisa EGF Cadherin_C_2 LapA_dom Baculo_11_kDa Sigma_reg_N TMEM52 Vpu EphA2_TM DAG1
Other DBs
NCBI-GeneID: 100387579
NCBI-ProteinID: XP_002745770
Ensembl: ENSCJAG00000019979
UniProt: F7B288
LinkDB
Position
3
AA seq 178 aa
MDPATPGSGASSLPLLLALALGLVILHCVVADGNSTGSPETNGLLCGDPKENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYLGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVVGVCTCCHPLRKHRKRKRKEEEMETLGKDVTPINEDIEETNIA
NT seq 537 nt   +upstreamnt  +downstreamnt
atggacccggccaccccgggcagcggcgccagctccctgccactgctcctggcccttgcc
ctgggtctagtgatcctccactgtgtggtggcagatgggaattccactggaagtcctgaa
actaatggccttctctgcggagatcccaaggaaaactgtgcagctaccactacacaatca
aagcggaaaggccacttctctaggtgccccaagcaatacaagcattactgcattaaagga
agatgccgcttcgtggtggccgagcagacgccctcctgtgtctgtgatgaaggctacctt
ggagcaaggtgtgagagagttgacttgttttacctaagaggagacagaggacagattctg
gtgatttgtttgatagcagttatggtagtttttattattttggttgttggtgtctgcacg
tgctgtcatcctcttcgaaaacatcgtaaaagaaagaggaaagaagaagaaatggaaact
ctgggtaaagatgtaactcctatcaatgaagatattgaagagacaaatattgcttaa

DBGET integrated database retrieval system