KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387683
Entry
100387683         CDS       T03264                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04012  ErbB signaling pathway
cjc04062  Chemokine signaling pathway
cjc04110  Cell cycle
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04360  Axon guidance
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04657  IL-17 signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04728  Dopaminergic synapse
cjc04910  Insulin signaling pathway
cjc04916  Melanogenesis
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease
cjc04934  Cushing syndrome
cjc04935  Growth hormone synthesis, secretion and action
cjc05010  Alzheimer disease
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05135  Yersinia infection
cjc05160  Hepatitis C
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05215  Prostate cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100387683 (GSK3B)
   04310 Wnt signaling pathway
    100387683 (GSK3B)
   04340 Hedgehog signaling pathway
    100387683 (GSK3B)
   04390 Hippo signaling pathway
    100387683 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100387683 (GSK3B)
   04150 mTOR signaling pathway
    100387683 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100387683 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100387683 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100387683 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100387683 (GSK3B)
   04657 IL-17 signaling pathway
    100387683 (GSK3B)
   04662 B cell receptor signaling pathway
    100387683 (GSK3B)
   04062 Chemokine signaling pathway
    100387683 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100387683 (GSK3B)
   04917 Prolactin signaling pathway
    100387683 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100387683 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100387683 (GSK3B)
   04916 Melanogenesis
    100387683 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100387683 (GSK3B)
   04722 Neurotrophin signaling pathway
    100387683 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100387683 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387683 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100387683 (GSK3B)
   05225 Hepatocellular carcinoma
    100387683 (GSK3B)
   05226 Gastric cancer
    100387683 (GSK3B)
   05217 Basal cell carcinoma
    100387683 (GSK3B)
   05215 Prostate cancer
    100387683 (GSK3B)
   05213 Endometrial cancer
    100387683 (GSK3B)
   05224 Breast cancer
    100387683 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100387683 (GSK3B)
   05020 Prion disease
    100387683 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100387683 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100387683 (GSK3B)
   04931 Insulin resistance
    100387683 (GSK3B)
   04934 Cushing syndrome
    100387683 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100387683 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100387683 (GSK3B)
   05162 Measles
    100387683 (GSK3B)
   05163 Human cytomegalovirus infection
    100387683 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100387683 (GSK3B)
   05165 Human papillomavirus infection
    100387683 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100387683 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100387683 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100387683 (GSK3B)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100387683 (GSK3B)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100387683 (GSK3B)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100387683 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100387683
NCBI-ProteinID: XP_017820696
Ensembl: ENSCJAG00000008783
UniProt: F6V0J0
LinkDB
Position
15
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccgcaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtataccaagccaaactttgtgattcgggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagaactccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatattcattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagccgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtggaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtacgggtcttccgacct
cgaactccaccagaggcgattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctggctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccccacaaatgccacagcagcctcagatgctaatactggagaccgtggacag
accaataatgctgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system