KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387773Help
Entry
100387773         CDS       T03264                                 

Gene name
CPSF7
Definition
(RefSeq) cleavage and polyadenylation specific factor 7
  KO
K14398  cleavage and polyadenylation specificity factor subunit 6/7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100387773 (CPSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100387773 (CPSF7)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     100387773 (CPSF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 100387773
NCBI-ProteinID: XP_002755455
Ensembl: ENSCJAG00000019282
LinkDB All DBs
Position
11
AA seq 471 aa AA seqDB search
MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPS
PKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRV
PRGGIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPP
PIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
ATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSSAISKAVSGAS
AGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaggagtggacttgattgatatatatgcagacgaggagttcaaccaggaccca
gagttcaataatacagatcagattgacctgtatgatgatgtgctgacagccacctcacag
ccttcagatgacagaagcagcagcactgagccacctcctcctgttcgccaggagccatct
cccaagcccaacaacaagacccctgcaattctgtatacctacagtggcctgcgtaataga
cgagctgccgtctatgtgggcagcttctcctggtggaccacagaccagcagctgatccag
gttattcgctctataggagtctatgatgtggtggagttgaaatttgcagagaatcgagca
aatggccagtccaaagggtatgctgaggtggtggtagcctctgaaaattctgtccacaaa
ttgttggaactcctaccaggaaaagttcttaatggagaaaaagtggacgtgaggccggcc
acccggcagaacctgtcacagtttgaggcacaggctcggaaacgtgagtgtgtccgagtc
ccaagagggggaatacctccacgggcccattctcgagattctagtgattctgctgatgga
cgggccacaccctctgagaacctagtaccctcatctgctcgtgtggataagccccccagt
gtgctgccctacttcaatcgtcctccttcagcccttcccctgatgggtctgcctccacca
ccaattccacccccaccacctctctcctcaagctttggggtccctcctcctcctcctggt
atccactaccagcatctcatgcccccacctcctcgattacctcctcatcttgctgtacct
ccccctggggccatcccacctgcccttcacctcaatccagccttcttccccccaccaaac
gctacagtggggcctccaccagatacttacatgaaggcctctgccccctataaccaccat
ggcagccgagattcgggtcctccaccctctacagtgagtgaagctgaatttgaagatatc
atgaagcgaaacagagcaatttccagcagtgccatttccaaagcggtatctggagccagt
gcaggggattacagtgacgcaattgagacgctgctcacagccattgcggttatcaaacag
tcccgggtcgccaatgatgagcgttgccgtgtcctcatctcctctcttaaggactgtctt
catggcattgaagccaagtcctacagcgtgggtgccagtgggagctcttccaggaaaaga
catcggtcccgggaaaggtcacctagccggtcccgggagagcagcaggaggcaccgggat
ctgcttcataatgaagatcggcatgatgattatttccaagaaaggaaccgggagcacgag
agacaccgggatagagaacgggaccggcaccactga

DBGET integrated database retrieval system