KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387874
Entry
100387874         CDS       T03264                                 

Gene name
PAK6
Definition
(RefSeq) p21 (RAC1) activated kinase 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04660  T cell receptor signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05170  Human immunodeficiency virus 1 infection
cjc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100387874 (PAK6)
   04014 Ras signaling pathway
    100387874 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100387874 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100387874 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100387874 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    100387874 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100387874 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100387874 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100387874 (PAK6)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100387874 (PAK6)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100387874 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100387874
NCBI-ProteinID: XP_009003818
Ensembl: ENSCJAG00000020882
UniProt: F7HZL3
LinkDB
Position
10
AA seq 681 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGNAVPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHQQMPWPEPQSPRVLSNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTATSRHGMKAAKHGSEEARPQSCLVGSATSR
PGGEGGPSPKTQESSLKRRLFRSMFLSTAATAPPSSSKLGPPPQSKPNSSFRPLQKENPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGPFPGRSSPAGSPRTRHAQIS
TSNLYLPQDPTVTKGTLAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYAKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHINVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDCPPPKLKNSHKVSPMLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagccccacagaacttccagcac
cgtgtccatacctccttcgaccccaaagaaggcaagtttgtgggcctccccccacaatgg
cagaacattctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcacg
cgggtgcagctccaacccatgaagacagtggtacgtggcaatgcggtgcctgtggacggc
tacatctcggggctgctcaacgacatccagaagctgtcagtcatcagctccaacactctg
cgtggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccactgacccagacatgtacctccagagccctcagtctgagcgcactgacccc
catggcctctacctcagctgcaacgggggcacaccagcaggccaccagcagatgccatgg
cctgagccacaaagcccacgggtcctgtccaatgggctagctgcaaaggctcagtccctg
ggccccgccgagttccagggcgcctcgcagcgctgtctgcagctgggtgcctgcctgcag
agctccccaccaggagcctcgccccccacagccaccagtcggcatggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcttggtgggctcagccacgagcagg
ccaggtggggaaggcggccctagccctaagacccaggagagcagcctgaagcgcaggcta
ttccgaagcatgttcctgtccactgctgccacagcccctccaagcagcagcaagctgggc
cctccaccacagagcaagcccaactcgtctttccgaccgctgcagaaagaaaacccccca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccacttcggataccagcagcccccagaagtccctccgaacagctccggccacaggc
ccatttccaggccggtcttccccagcaggttccccccgcacccggcacgcccagatcagc
accagcaacctgtacctgccccaggaccccacagtcaccaagggcaccctggctggtgag
gacacaggtgttgtgacgcatgagcagttcaaggcagcgctcaggatggtggtggaccag
ggcgacccccggctgctgctggacagctacgcgaagattggcgagggctccaccggcatc
gtctgcttggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacatcaacgtggtggagatgtacaagagctacctggtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgaa
gagcagatcgccactgtgtgtgaggctgtgctgcaggccctggcctacctgcatgcccag
ggcgtcatccaccgggacatcaagagtgactccatcttgctgaccctcgatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtggatggggagccaccc
tacttcagcgactccccagtgcaagccatgaagaggctccgggactgtcccccgcccaag
ctgaaaaactctcacaaggtctcccccatgcttcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagaccaccccttcctgctgcag
acagggctgcccgagtgcctggtgcccctgatccagctctaccgcaagcagacctccacc
tgctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392970
Entry
100392970         CDS       T03264                                 

Gene name
PAK1
Definition
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04360  Axon guidance
cjc04392  Hippo signaling pathway - multiple species
cjc04510  Focal adhesion
cjc04625  C-type lectin receptor signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04810  Regulation of actin cytoskeleton
cjc05132  Salmonella infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100392970 (PAK1)
   04012 ErbB signaling pathway
    100392970 (PAK1)
   04014 Ras signaling pathway
    100392970 (PAK1)
   04392 Hippo signaling pathway - multiple species
    100392970 (PAK1)
   04024 cAMP signaling pathway
    100392970 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100392970 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100392970 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100392970 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    100392970 (PAK1)
   04660 T cell receptor signaling pathway
    100392970 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    100392970 (PAK1)
   04062 Chemokine signaling pathway
    100392970 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    100392970 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100392970 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100392970 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100392970 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100392970 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100392970 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100392970 (PAK1)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100392970 (PAK1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100392970 (PAK1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100392970 (PAK1)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100392970 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    100392970 (PAK1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100392970 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 100392970
NCBI-ProteinID: XP_002754843
Ensembl: ENSCJAG00000014954
UniProt: F7GZK8
LinkDB
Position
11
AA seq 547 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRN
TEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAI
KQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTE
TCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQ
SKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIAT
NGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAK
EATKNNH
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcaccatgattggagccggcagcaaagatcctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaagagaagaaaaagaaggaccgattttacagatccatcctacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctcttccttcagat
tttgaacacacaattcatgtcggttttgatgctgtcacgggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcaccaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcaaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattataattcttctaatgctttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaagatgatgat
gatgatgatgatgatgctaccccaccaccagtgattgctccacgcccagaacacacaaaa
tctgtatacacacgctctgtgattgaaccacttcctgtcactccaactcgggacgtggct
acatctcccatttcacctactgaaaataacaccactccaccagatgctttgacccggaat
actgagaagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacga
agcatagtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaa
ggtgcttcaggtaccgtgtacactgcaatggatgtggccacaggacaggaggtggccatt
aagcagatgaatcttcagcagcagcccaagaaagagctgataattaatgagatcctggtc
atgagggaaaacaagaacccaaacattgtgaattacttggacagttaccttgtgggagat
gagctatgggttgttatggaatacttggctggaggctccttgacagacgtggtgacagaa
acctgcatggatgaaggccagattgcagctgtgtgccgtgagtgtctgcaggctctggag
tttttgcattcgaaccaggtcattcacagagacatcaagagcgacaatattctgttggga
atggatggctctgtcaagctaactgattttggattctgtgcacagataaccccagagcag
agcaaacggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacga
aaggcctatgggcccaaggttgacatctggtccctgggcatcatggccattgaaatgatt
gaaggggagcctccatacctcaatgagaaccctctgagagccttgtacctcattgccacc
aatgggaccccagaacttcagaacccagagaagctgtcagctatcttccgggactttctg
aaccgctgtcttgagatggatgtggagaagagaggttcagctaaagagctgctgcagcat
caattcctgaagattgccaagcctctctccagcctcactccactgattgctgcagcaaag
gaggcaacaaagaacaatcactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394713
Entry
100394713         CDS       T03264                                 

Gene name
PAK4
Definition
(RefSeq) p21 (RAC1) activated kinase 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04660  T cell receptor signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05170  Human immunodeficiency virus 1 infection
cjc05206  MicroRNAs in cancer
cjc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100394713 (PAK4)
   04014 Ras signaling pathway
    100394713 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100394713 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100394713 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100394713 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    100394713 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100394713 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100394713 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100394713 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100394713 (PAK4)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100394713 (PAK4)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100394713 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 100394713
NCBI-ProteinID: XP_002762138
Ensembl: ENSCJAG00000014040
UniProt: F7AWJ1
LinkDB
Position
22
AA seq 593 aa
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLGEFENMSVTRSNSLRRDSPPPPARARQENGIPEE
PAATARAVSGKAGSRGRITGHSEAGGGSGDRRRAGPEKRPKSSREGSGDPQESSRDKRPL
SGPDVSIPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGDPHDVAPNGPSAGGLAVP
QSSSSSRPPARVRGAPSPGVLGPHASEPQLAPPARTSAAPTAPAVPGPPGPRSPQREPQR
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKVSPSLKGFLDRLLVRDPTQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtagagatctccgcgccatccaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcactgggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccctgcctgcatcacc
tccatccagcctggggcccccaagaccatcgtgcggggcagcaaaggtgccaaggatggg
gccctcacgctgctgctgggcgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccgccaggaaaatgggataccggaggag
ccggccgccacggccagagcagtctcagggaaggcaggcagtcgaggccggatcaccggt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggcggggccagagaagaggccc
aagtcttccagggagggctcaggggacccccaggagtcctcccgggacaaacgccccctc
tctgggcctgacgtcagcatccctcagcctgctggtctggccagtggggcgaaactggca
gctggccggccctttaacacctacccgagggctgacaccgaccacccatcccggggtgcc
cagggggatcctcacgacgtggcccctaatgggccatcagcgggtggcctggccgtcccc
cagtcctcctcctcctcccggcctcccgcccgagtccgaggcgcccccagccctggagtg
ctgggcccccatgcctcggagccccaactggcccctccagcccgcacctctgctgccccc
accgcccctgctgttcctgggccccctggcccccgctcaccacagcgggagccacagcgc
gtatcacatgagcagttccgggctgccctgcagctggtggtggacccgggcgacccccga
tcctacctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatcgcc
accgtgcgcagctcaggcaagctggtggctgtcaagaagatggacctgcgcaagcagcag
aggcgtgagctgctcttcaacgaggtggtgatcatgcgggactatcagcatgagaacgtg
gtggagatgtacaacagctacttggtgggggacgagctctgggtggtcatggagttcctg
gaaggaggagccctcaccgacattgtcacgcacaccaggatgaacgaggaacagatcgca
gccgtgtgcctggcagtgctgcaggccctatcggtgcttcatgcccagggcgtcatccac
cgggacatcaagagcgactcgatcctgctgacccatgatggcagggtgaagctgtcagac
ttcgggttctgcgcccaggtgagcaaggaagtgccccggaggaagtcgctggtcggcacg
ccctactggatggccccagagctcatctcccgacttccctacgggccagaggtggatatc
tggtcactggggataatggtgatcgagatggtggacggagagcccccctactttaacgag
ccacccctcaaagccatgaagatgattcgggacaacctgccgccccgactgaagaaccta
cacaaggtgtcgccttccctgaagggcttcctggaccgcctcctggtgcgggaccccact
cagcgggctacggctgccgagctgctgaagcacccattcctggccaaggcgggaccccct
gccagcatcgtacccctcatgcgccagaaccgcaccagatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405552
Entry
100405552         CDS       T03264                                 

Gene name
PAK2
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04660  T cell receptor signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05170  Human immunodeficiency virus 1 infection
cjc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100405552 (PAK2)
   04012 ErbB signaling pathway
    100405552 (PAK2)
   04014 Ras signaling pathway
    100405552 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100405552 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100405552 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100405552 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    100405552 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100405552 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100405552 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100405552 (PAK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100405552 (PAK2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100405552 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 100405552
NCBI-ProteinID: XP_002758272
Ensembl: ENSCJAG00000013687
UniProt: F7ASR5
LinkDB
Position
15
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGSETSAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSNVDGGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcacctcctgtgcgaatgagcagt
accatttttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccttctgttccagaggagaaaaagcccaggaataaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gaacacactatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctagatgtcttaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggcttcccttctggaacaccagcattgaatgccaag
ggatcagaaacatcagcagtagtgacagaggaagatgatgatgacgaagaaactgctcct
cctgttattgccccacgaccagatcatacaaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcaaatgttgatggtggtgccaagtcttcagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgatgttgcattgggacaggaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaaaaatcccaacatagttaacttcttggacagttacctggtaggagatgaattgttt
gtggtaatggagtaccttgctggtgggtcacttactgatgttgtaacagaaacctgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagatatcaaaagtgacaatgtacttttgggaatggaagga
tcagttaaacttactgactttggtttctgtgcccagatcactcctgagcagagcaaacgc
agtaccatggtcggaacaccatattggatggcaccagaggtggttacacggaaagcttac
ggccctaaagttgatatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagaacttcagaatccagaaaaactttccccaatatttcgggatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcctg
aaactggccaaaccactgtctagcttgacaccattgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411048
Entry
100411048         CDS       T03264                                 

Gene name
PAK5
Definition
(RefSeq) p21 (RAC1) activated kinase 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04660  T cell receptor signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05170  Human immunodeficiency virus 1 infection
cjc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100411048 (PAK5)
   04014 Ras signaling pathway
    100411048 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100411048 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100411048 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100411048 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    100411048 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100411048 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100411048 (PAK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100411048 (PAK5)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100411048 (PAK5)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100411048 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100411048
NCBI-ProteinID: XP_002747400
Ensembl: ENSCJAG00000021343
UniProt: F7DBS7
LinkDB
Position
5
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHV
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEMKPFKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSHLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKAGYSSSSHQYPAGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccatccaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttaccggccttccacagcaatggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggacccttcatgtattaca
cccatacagctggctcctatgaagacaatcgttagaggaaacaaaccgtgcaaggaaacc
tccatcaatggcctgctagaggatttcgacaacatctcggtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgtg
gaagaaaacggcttcatcaccttctcccagtattccagcgaatccgatactactgctgac
tacacaactgaaaagtacagagagaagagtctctatggagacgacctggatccgtattac
agaggcagccatgcagccaagcaaaatgggcatgtaatgaaaatgaagcacggggaggcc
tactattctgagatgaagccttttaaatcagattttgccagattttctgcagattatcac
tcacatttggactcactgagcaaaccaagtgagtatagtgacctcaagtgggagtatcag
agagcctcgagtagctcccatctggattattcattccaattcacaccttctagaactgca
gggaccagtgggtgctccaaggagagcctggcctacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccaaagtcatcgtacctaaatcagacgagccctcagccc
accatgcggcagaggtccaggtcaggctcggggctccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacaactcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaagcaggctattcctcaagcagccaccagtatccggctgggtaccacaaagcc
accttgtaccaccacccttccctgcagagcagttcgcagtacatctccacggcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggctcctcctct
gaccagcagccctccagggtgtcccatgaacagtttcgggcagccctgcagctggtggtc
agcccaggagaccccagggaatacttggacaactttatcaaaatcggggaaggctcaacc
ggcatcgtgtgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgggaactgctttttaatgaggtcgtgatcatgcgggat
taccaccatgacaatgtggttgacatgtacaacagctaccttgttggtgatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacatcgtgactcacaccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagtgatggc
cggataaagttatctgattttggtttctgtgctcaagtttccaaagaagtgccaaagagg
aaatcattggttggcactccctactggatggctcctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtccctcgggatcatggtgattgaaatgatcgatggcgag
cccccttacttcaatgagccccctctccaggcgatgcggaggatcagggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggatttctagacctgatg
ttggtgagggagccctctcagagagcaacagcacaggaactccttggacatccattttta
aaactagcaggtccaccatcttgcatcgtccccctcatgagacaatacagacatcactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413676
Entry
100413676         CDS       T03264                                 

Gene name
PAK3
Definition
(RefSeq) p21 (RAC1) activated kinase 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04660  T cell receptor signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05132  Salmonella infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100413676 (PAK3)
   04014 Ras signaling pathway
    100413676 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100413676 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100413676 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100413676 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    100413676 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100413676 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100413676 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100413676 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100413676 (PAK3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100413676 (PAK3)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100413676 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N DSHCT APH Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 100413676
NCBI-ProteinID: XP_002763210
Ensembl: ENSCJAG00000007168
UniProt: U3C3D3
LinkDB
Position
X
AA seq 544 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEE
EEDDNEPPPVIAPRPEHTKSIYTRSVVESIASQAAPNKEVTPPSAENANSSTLYRNTDRQ
RKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIK
NSSR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccagctcccccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgtccagagatctctcttccttcagactttgagcatacgatt
catgttgggtttgatgcagtcaccggggaattcactggaattcctgagcaatgggcacga
ttactccaaacctccaacataacaaaattagaacagaagaagaacccacaagctgttcta
gatgttctcaaattctatgattccaaagaaacagtcaacaaccagaaatacatgagcttt
acatcaggagataaaagcgcacatggatacatagcagcccatccttcgagtacaaaaaca
gcatctgaacctccattggcccctcctgtgtctgaagaagaagatgaagaggaggaggag
gaagaagatgacaatgagcccccaccagttattgcaccaagaccagagcatacaaaatca
atctacactcgttctgtggttgaatccattgcttcacaagcagcaccaaataaagaggtc
acaccaccctctgctgagaatgccaattccagtactttgtacagaaacacagatcggcaa
agaaaaaaatccaagatgacagatgaggagatcttagagaaactaagaagcattgtgagt
gttggggacccaaagaaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggt
actgtttatacagcactagacattgcaacaggacaagaggtggccataaagcagatgaat
cttcaacagcaacccaaaaaggaattaattattaatgaaattctggtcatgagggaaaat
aagaaccctaatattgttaattatttagatagctacttagtgggtgatgaactatgggta
gtcatggaatacttggctggtggctctctgactgatgtggtcacggagacctgtatggat
gaaggacagatagcagctgtctgcagagagtgcctgcaagctttggatttcttgcactca
aaccaggtgatccatagagatataaagagtgacaatattcttctcgggatggatggctct
gttaaattgactgactttgggttctgtgcccagatcactcctgagcaaagtaaacgaagc
actatggtgggaaccccgtactggatggcacctgaggtggtgactcgaaaagcttatggt
ccgaaagttgatatctggtctctgggaattatggcaattgaaatggtggaaggtgaaccc
ccttaccttaatgaaaatccactcagggcattatatctgatagccactaatggaacccca
gagctccagaatcctgagagactgtcagctgtattccgtgactttttaaatcgctgtctt
gagatggatgtggataggcgaggatctgccaaggagcttttgcagcatccatttttaaaa
ttagccaagcctctttccagtctgactcctctgattatcgcagcaaaggaagcaattaag
aacagcagccgctaa

DBGET integrated database retrieval system