KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387931
Entry
100387931         CDS       T03264                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04390  Hippo signaling pathway
cjc05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100387931 (AREG)
   04012 ErbB signaling pathway
    100387931 (AREG)
   04390 Hippo signaling pathway
    100387931 (AREG)
   04151 PI3K-Akt signaling pathway
    100387931 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100387931 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjc03110]
    100387931 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100387931 (AREG)
Chaperones and folding catalysts [BR:cjc03110]
 Intramolecular chaperones
  Others
   100387931 (AREG)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100387931 (AREG)
SSDB
Motif
Pfam: EGF FtsL Jak1_Phl HHV-5_US34A
Other DBs
NCBI-GeneID: 100387931
NCBI-ProteinID: XP_002745771
Ensembl: ENSCJAG00000013848
UniProt: F7CE46
LinkDB
Position
3
AA seq 252 aa
MRAPLLPPVPVVLSLLILCSGHYAAGLDLNDTYSGKSEPFPGDQSADGFEVTSRSEMSSR
SELSPESEMSSSSELSSGTDDDYSEEYDNEPQIPGYIVDDSVRVEQVVKPQKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFHNFCIHGECKYIVHLEAVTCKCQQDYFGER
CGEKSMKTHSMTDSNLSKIALPAIAAFIAAVILTAIAVITVQFRKLYLRKYEGEAEERKK
LRQENGNVHAIA
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctgccgccggtgccggtggtgctgtcgctcttgatcctctgctca
ggccattatgctgctggattggacctcaatgacacctactctgggaagagtgaaccattt
cctggggaccaaagtgctgatggatttgaggttacctccagaagtgagatgtcttcaaga
agtgagctttcacctgagagtgaaatgtcttctagtagtgaactgtcgtcgggaaccgac
gatgactattcagaagagtatgataatgaaccacaaatacctggctatattgtagatgat
tcagtcagagttgaacaggtagttaaaccccaaaaaaacaagacagaaagtgaaaatact
tcagataaacccaaaagaaagaaaaaaggaggcaaaaatggaaaaaatagaagaaacaga
aagaagaaaaatccatgtaatgcagaattccacaatttctgcattcatggagaatgcaaa
tatatagtacacctggaagcagtaacatgcaaatgtcagcaagattactttggtgaacgg
tgtggggagaagtccatgaaaactcacagcatgactgacagtaatttatctaaaattgca
ttaccagccatagctgcctttatagctgccgtgatcctcacagctattgctgttattaca
gtccagtttagaaaactatatttaaggaaatatgaaggagaagctgaggaaagaaaaaaa
cttcggcaagaaaatggaaatgtacatgccatagcataa

DBGET integrated database retrieval system