KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387965
Entry
100387965         CDS       T03264                                 

Gene name
GPR119
Definition
(RefSeq) G protein-coupled receptor 119
  KO
K08424  glucose-dependent insulinotropic receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100387965 (GPR119)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100387965 (GPR119)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100387965 (GPR119)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Lipid
   Oleoylethanolamide
    100387965 (GPR119)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100387965
NCBI-ProteinID: XP_002763304
Ensembl: ENSCJAG00000022479
LinkDB
Position
X
AA seq 335 aa
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVNLCFTLNLAVADTLIGVAISG
LLTEQLSSSSQPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPLRYLKIMSGF
VARACIAGLWLVSYLIGFLPIGVPMFQQTPYKEPCSFFAVFHPRFVLALSCVGFFPAMLL
FVFFYCDMLKIASMHSQQIRKMEHARAMAGGYRPPRTPSDFKALRTVSVLIGSFTLSWTP
FLITGIVQVACQECRLYPVLEQYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV
LTSFLLFLLARNDGLERPRESSCHIVTISNSEFDG
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggagtcatctttctcatttggagtgatccttgctgtcctggcctccctcatcattgct
actaacacactagtggctgtggctgtgctgctactgattcacaagaatgatggtgtcaat
ctctgcttcaccttgaatctggctgtggctgacaccttgattggcgtggccatctctggc
ctactcacagaacagctctccagctcttctcagcccacacagaagaccctgtgcagcctg
cgaatggcatttgtcacttcctctgcagctgcctctgtcctcacagtcatgctgatcacc
tttgacaggtaccttgccatcaagcagcccctccgctacctgaagatcatgagtgggttt
gtggccagggcctgcattgctgggctgtggttggtgtcttacctcattggcttcctccca
attggagtccctatgttccagcagaccccctacaaagagccctgcagcttctttgccgta
tttcaccctcgcttcgtgctagccctctcctgtgttggcttcttcccagccatgctcctc
tttgttttcttctattgtgacatgctcaagattgcctccatgcacagccagcaaatccga
aagatggaacatgcaagagccatggctggaggttatcgacccccacggactcccagcgac
ttcaaagctctgcgcactgtgtctgtactcattgggagcttcactctatcctggaccccc
ttccttatcactggcattgtgcaggtggcctgccaggagtgtcgcctctacccagtgctg
gaacagtacctgtggttgctcggtgtgggcaactccctgctcaacccactcatctatgcc
tattggcagaaagaggtgcgactacagctctaccacatggccctgggagtaaagaaggtg
ctcacctcattcctcctctttctcttggccaggaatgatggcctagagaggcccagggaa
agttcctgtcacattgtcactatctccaactcagagttcgatggctaa

DBGET integrated database retrieval system