KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388003Help
Entry
100388003         CDS       T03264                                 

Gene name
TTBK2
Definition
(RefSeq) tau tubulin kinase 2
  KO
K08815  tau tubulin kinase [EC:2.7.11.26]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100388003 (TTBK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100388003 (TTBK2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CK1 group
  TTBK family
   100388003 (TTBK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100388003
NCBI-ProteinID: XP_009003549
Ensembl: ENSCJAG00000001912
LinkDB All DBs
Position
10
AA seq 1150 aa AA seqDB search
MQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFP
STCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLF
YMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDY
QLLTSVFDNSIKTFGVIESDPFDWEKTGTDGSLTTTTTSTTPQLHTRLTPAAIGIANATP
IPGDLLRENTDEVFPDEQLSDGENGIPVGVSPDKLPGSLGQPRPQEKDVWEEMDANKNKI
KLGICKAATEEENSHGQANGLLNAPSLGSPIRVRSEITQPDRDIPLVRKLRSIHSFELEK
RMTLESKPDTDKFLETCLEKMQKDTSAGKESILPALLHKPCVPAVSRTDHIWHYDDEYLP
DASKPASANTPEQGDGGGSNGFIAVNLSSCKQEIDSKEWVIVDKEQDLEDFRTNEVVGHK
TTGSPSDEEPEVLQVLEVSPQDEKLRLGPWAENDHLKKETSGVVLAFCAEGPPTAASEQY
TDGLELQPGAASQFIAATPTSLMEAQAEGPLTAITIPRPSVASTQSTSGSFHYGQQPEKK
DLQPMEPTVELYSPRENFSGLVVTEGEPPSGGSRTDLGLQLDHIGHDMLPNFRESNQSQD
LGPKELPDHNRLVVGEFENLPGESEEKSILLESDKEDEKLSRGQHCVELSSLPDLLMVEK
DHSATTEPLDVTKTQTFSVVPNQDKNKEVMKLLTVGTSEMSPRDIDPHVEGQIGQVAEMQ
KSKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKIAPRNGELFHCVSENEHGAPTRKDMV
RSSFVTRHSRIPVLAQEIDSTLELSFPVSAKEKLLQKKAYQPDLVKLLVEKRQFKSFLGD
LSSASDKLLEEKLATVPASFCEEEVLTPFSRLTVDSHMSRSAEDSFLSPIISQSRKSKIP
RPVSWVNTDQVNSSTSSPFFPRPPPGKPPTRPGVEARLRRYKVLGSSNSDSDLFSRLAQI
LQNGSQKPRSTTQCKSPGSPHNPKTPPKSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRP
HHDQRSSSPHLGRSKSPPSHSGSSSSRRSCQQEHCKPSKNGLKGSGSLHHHSANAKPPPV
KSKPASKLSR
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcagggtcgtaatctggcagatcttcgccgtagccagtcccgaggcacattc
accatcagtactactctccggctgggtagacagatattggagtctatagaaagcattcat
tctgtgggattcttgcaccgagacatcaaaccgtcgaacttcgctatgggtcgctttcct
agtacatgtaggaaatgttacatgcttgattttggcttggctcgacaatttaccaattcc
tgtggtgacgtcagaccacctcgagctgtggcagggtttcgagggacagttcgttatgca
tcagtcaacgctcatcggaacagggaaatgggaagacatgatgacctttggtccttattc
tacatgttggtggaatttgtggttggtcagctgccttggagaaaaataaaggacaaggag
caagtaggctctattaaggagagatatgaccacaggctcatgttgaaacatctccctcca
gaattcagcatctttctagaccatatttcctctttggattattttacaaaaccagactac
cagcttcttacatccgtgtttgacaatagcatcaagacttttggagtaattgagagtgac
ccttttgactgggagaagactggaactgatggctccctaacaaccaccactacttctacc
acccctcagttgcacactcgcttgacccctgctgcaattggaattgccaatgccactccc
ataccaggagacttgcttcgagaaaatacagatgaggtatttccagacgaacagcttagt
gatggagaaaatggcatccctgttggtgtgtcaccagataaattgcctggatctctggga
cagcctcgtccccaggagaaggatgtttgggaagagatggatgccaacaaaaacaagata
aagcttggaatttgtaaggctgctactgaagaggagaacagccatggccaagcaaatggt
cttctcaatgctccgagccttgggtcaccaattcgtgtccgctcagagattactcagcca
gacagagatattccattggtgcgaaagttacgttccatccacagctttgagctggaaaaa
cgtatgaccctggagtcaaagccagacactgacaagttccttgagacctgcctggagaaa
atgcagaaagataccagtgcaggaaaagaatctattctccctgctctgcttcataagcct
tgtgttcctgctgtgtcccgtactgaccatatctggcactatgatgatgaatatcttcca
gatgcctccaagccagcttctgccaacacccctgagcagggagatggtggtggcagcaat
ggatttatagctgttaacctgagctcttgcaagcaagagattgattccaaagaatgggtg
attgtggacaaggagcaggaccttgaagattttaggacaaatgaggttgtaggacataaa
acaactggaagtccttctgatgaggaacctgaagtgcttcaagtcctggaggtatcacct
caagatgaaaagctccgattaggtccttgggcagaaaatgatcatttaaagaaggaaacc
tcaggtgtggtcttagcattttgtgcagagggtcctcccactgccgcttcagaacaatat
acagatggactggaactccagcctggagctgctagtcagtttattgcagcaacacccaca
agtctaatggaggcgcaggcagaaggaccccttacagcgattacaattcctagaccttct
gtggcatctacgcagtcaacttcaggaagctttcactatggtcagcagccagagaagaaa
gatcttcagcccatggagcccactgtggaactttactctccaagggaaaacttctctggc
ttggttgtgacagagggtgaacctcctagtggaggaagcagaacagatttggggcttcag
ttagatcacattggtcatgacatgttacccaactttagagaaagtaaccaatctcaagat
ctgggaccaaaagaacttcctgatcataacagactggttgtgggagaatttgaaaatctc
cctggggaaagtgaagagaaaagcatccttttagagtcagataaagaagatgagaagtta
agtagagggcagcattgtgttgagctctcctctctcccagatttgttaatggtggaaaag
gatcactcagctactactgaacctcttgatgtgacaaaaacacagacttttagtgtggtg
ccaaatcaagacaaaaataaggaggtaatgaagcttctgacagttggaacttcagaaatg
tctcccagagacattgacccacatgttgaaggtcagataggccaggtggcagaaatgcaa
aaaagtaagatatctaaggatgatgacatcatgagtgaagacttgccgggtcatcaaggg
gacctctctacttttttgcaccaagagggtaagagagagaaaattgcccctagaaatgga
gaactgtttcattgtgtctcagagaatgaacatggtgccccaacccggaaggatatggtt
aggtcatcctttgtaactagacacagccgaatccctgttttagcacaagagattgactca
actttggaattatcctttccagtctctgcaaaagaaaagctcctccaaaagaaagcttat
cagccagacctagtcaagcttctggtggaaaaaagacaattcaagtccttccttggcgac
ctctcaagtgcctctgataaattactagaagagaaactagctactgttcctgcttccttt
tgtgaggaggaagtcctcactcccttttcaagactgacagtagattctcacatgagcagg
tcagctgaagatagctttctgtcacccatcatctcccagtctagaaagagcaaaattcca
aggccagtatcatgggtcaacacagatcaagtcaatagctcaacttcatctccgttcttt
cctcggccacccccaggaaagccacccacgaggcctggagtagaagccaggttacgcaga
tataaagtcctagggagtagtaactctgactcagaccttttctcccgcctggcccaaatt
cttcaaaatggatctcagaaaccccggagcactactcagtgcaagagtccaggatctcct
cacaaccccaaaacaccacccaagagtccagttgtccctcgcaggagtcccagtgcctct
cctcgaagctcatccttgcctcgcacatctagttcctcaccatctagggctggacggccc
caccatgaccagaggagttcatccccacatctggggagaagcaagtcacctcccagccac
tcaggatcttcgtcctccaggaggtcctgccaacaggagcattgcaaacccagcaagaat
ggcctgaaaggatctggcagcctccaccaccactcagccaacgctaaaccccccccagtg
aagagtaagccagccagtaaactcagcagatag

DBGET integrated database retrieval system