KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388154Help
Entry
100388154         CDS       T03264                                 

Gene name
COL8A1
Definition
(RefSeq) collagen type VIII alpha 1 chain
  KO
K23455  collagen, type VIII, alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100388154 (COL8A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 100388154
NCBI-ProteinID: XP_002758914
Ensembl: ENSCJAG00000000632
LinkDB All DBs
Position
15
AA seq 745 aa AA seqDB search
MAVLPDPLQLLGMLLTIFLSSIRLIQAGAYYGIKPLPPQIPPQMPLQIPQYQPLGQQVPH
MPLAKDGLAMGKEMPQLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKVEIPLASLRGE
QGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKG
EIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGLKGLPGPQGLRGP
KGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGVPGEPGPQG
PIGVPGVQGPPGIPGVGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPK
GDRGMGGVPGALGPRGEKGPVGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIV
GPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGHKGLPGLPGVPGLL
GPKGEPGIPGDQGLQGPPGIPGIAGPSGPIGPPGIPGPKGEPGLPGPPGFPGVGKPGVAG
LHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPH
AYGAKKSKNGGPAYEMPAFTAELTTPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPG
VYYFAYHIHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMP
SEQAAGLYAGQYVHSSFSGYLLYPM
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctgcccgaccctctgcagctgctgggaatgctgcttaccattttcctgagc
tccatcaggctcattcaggctggtgcctactatgggatcaagccgctgccacctcaaatt
cctcctcagatgccactgcaaattccacaataccagcccctgggtcagcaagtacctcat
atgcctttggccaaagatggccttgccatgggcaaggagatgccccagttgcagtatggc
aaagaatatccacacctaccccaatatatgaaggaaattcaaccggcgccaagaatgggc
aaggaagcagtacccaagaaaggcaaagtagaaataccattagccagtttacgaggggaa
caaggtccccgtggagagcctggcccaagaggaccacctgggccccctggtttgccaggt
catgggatacctggaattaaaggaaaaccagggccacagggatacccaggagttggaaag
ccaggtatgcctggaatgccagggaagccaggagccatgggcatgcctggggcaaaagga
gaaattggacagaaaggggaaattggacctatggggatcccaggaccacaaggacctcca
gggcctcatggacttcctggcattgggaagccaggtggtccagggttaccagggcaacca
ggaccaaagggtgatcgaggactcaaaggactaccaggacctcaaggccttcggggtcct
aaaggagacaagggcttcgggatgccaggtgcaccaggcgtgaagggccctccaggaatg
catggccctcctggccccgttggactgccaggagtgggcaaaccaggagtcacaggcttc
cctgggccccagggccccctgggaaagccaggggttccgggagaacctgggccacaaggc
cctattggggtaccaggggttcaaggacctcctgggatacctggagttggaaagccaggc
caggatgggatcccaggccagccaggatttccaggtggcaaaggggaacaaggactgcca
gggcttccgggacccccaggccttccagggattgggaaaccaggcttcccaggacccaaa
ggtgaccggggcatgggaggtgttccgggggctcttggaccaagaggggagaaaggacca
gtaggtgccccaggaatagggggtcctccaggagagccaggcctgcctggaatcccaggt
cctatgggtcctccaggtgctattggttttcctgggcccaaaggagaaggtgggattgta
gggccacaggggccaccaggtcccaagggtgagccaggccttcaaggcttcccaggaaag
cctggtttcctcggtgaagtagggcctcctggcatgaggggtttgccaggtcccataggg
cctaagggggaagctgggcacaaaggtttgccaggactccctggtgttccagggcttctc
ggacctaagggagagccaggaatcccaggggatcagggtttacagggccccccaggtatc
ccagggattgcaggccctagcggccccattggaccacctgggattccaggccccaagggg
gagccaggcctcccagggcctcccgggttccctggtgtaggaaaacctggagtggcagga
cttcatggccccccagggaagcctggtgcccttggtcctcaaggccaacctggccttcca
ggacccccaggccctccaggacccccaggacccccagctgtgatgccccctacaccacca
ccccagggagagtatctgccagatatggggctgggaattgatggtgtgaaacccccccat
gcctatggggctaagaaaagcaagaacggagggccagcgtatgagatgcctgcatttacc
gccgagctaaccacacctttcccaccggtgggggccccagtgaagtttgacaaactgctc
tataacggcagacagaactacaacccgcagacgggtatcttcacctgtgaggtccctggt
gtctactactttgcataccacattcactgcaaggggggcaacgtgtgggttgctctgttc
aagaacaacgagcccgtgatgtacacatatgatgagtacaaaaagggcttcctggaccag
gcgtctgggagcgcagtgctgctgctcaggcccggagaccgagtgttcctccagatgccc
tcagaacaggctgcgggactgtacgccgggcagtatgtccactcctccttttcaggatat
ttattgtatcccatgtaa

DBGET integrated database retrieval system