KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388373Help
Entry
100388373         CDS       T03264                                 

Gene name
MED19
Definition
(RefSeq) mediator complex subunit 19
  KO
K15137  mediator of RNA polymerase II transcription subunit 19
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100388373 (MED19)
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     100388373 (MED19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med19 Connexin
Motif
Other DBs
NCBI-GeneID: 100388373
NCBI-ProteinID: XP_002755339
Ensembl: ENSCJAG00000008642
UniProt: A0A2R8MVW7
LinkDB All DBs
Position
11
AA seq 261 aa AA seqDB search
MKITNARHLGSAEAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTA
PPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKE
KLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQC
RLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKN
RHSPDHPGMGSSQASSSSSLR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccaacgccagacatctaggcagcgccgaggcggaggggacgatggagaat
ttcacggcactgttcggggctcaggctgacccaccaccgcccccaaccgcactcggcttc
ggaccaggaaagcctccacccccgccaccacctcctccaggcgggggtcccggcacggcc
ccgcctcccaccgcagccacggcccctcccggcgcggacaagtcaggagctggctgtggc
cctttctacctaatgagggaactgccaggtagcacagagctcacaggcagcacgaatctg
atcacacattacaacttggaacaagcctataataaattctgtgggaagaaggtgaaggag
aagcttagtaacttcctgcctgacctgccagggatgattgatctgcctggttcccatgat
aacagcagcctccgctccctcattgagaagccccctattctcagcagctcttttaatcct
atcacagggaccatgctggccggcttccgcctccacactggcccgttgccagagcagtgt
cgtctgatgcatattcagcctcccaagaagaagaataagcacaagcacaaacagagccgt
acccaggatcctgtacccccagaaacaccatctgattcggatcacaagaagaagaaaaag
aaaaaagaagaggatcctgaaaggaaaaggaagaagaaagagaagaagaaaaagaagaac
cgacatagtccagaccaccccggtatgggtagttcccaggccagcagcagcagcagccta
cgctaa

DBGET integrated database retrieval system