KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388471
Entry
100388471         CDS       T03264                                 

Gene name
PCLO
Definition
(RefSeq) piccolo presynaptic cytomatrix protein
  KO
K16882  protein piccolo
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100388471 (PCLO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100388471 (PCLO)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    100388471 (PCLO)
SSDB
Motif
Pfam: zf-piccolo C2 PDZ FYVE_2
Other DBs
NCBI-GeneID: 100388471
NCBI-ProteinID: XP_003733655
LinkDB
Position
8
AA seq 4952 aa
MGNEASLEGEGLPEGLAAAAAAGGGASGAGSPSHTVIPAGMEADLSQLSEEERRQIAAVM
SRAQGLPKESVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPGLSKSRTTDTFR
SEQKLPGRSPSTISLKESKSRTDFREEHKSSMMPGFLSEVNPLSAVSSVVNKFNPFDLIS
DSEASQEEITKKQKVVQKEQGKPEGITKPPSQQQSPKPVPKQQGAGKDPLQQDGPPKLVS
SQQPEKIKSQPQGTGKPIQGPAQTPQTDQAKLSLQRDASRPQTKQADIVRGESVKPSLQS
PSKPPIQQPSPKKPPAQQPGPEKSQPGPAKPPAQPPGLTKPLAQQPGTVKPPVQPPGTTK
PPAQSLGPAKPPAQQTGSEKPSLEQPGPKALAQPPGVGKTPAQQPGPGKPPTQQVGTPKP
VAQQPGLQSPAKATGPTKTPVQQPGPGKTPAQQAGPAKPSAQQTGPTKLPSQLPGPAKPP
PQQPGSAKPPPQQPGSAKLPSQQPGSAKPLAQQPSPTKPSAQQSTKPVSQTGSAKPLQPP
TMSPSAKQPPSQGLPKTICPLCNTTELLLHVPEKANFNKCTECQTTVCSLCGFNPNPHLT
EVKEWLCLNCQMKRALGGDLAPVPSSPHPKPKTAPVTSTSAVSKSSPQSQQTSPKKDAAP
KQDVSKAPEPKKPPPLVKQPTLHGSPSAKAKQPPEADSSSKPAPPKESSVPSEQDKAPVA
DDKPKQTKTVKPPTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTG
EKITPVDSKAIPRPASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKITPKPDAKP
VPKGSPTPPSPRPTTGQTVPTPQQPPKSQEQSRRFSLNLGSITDAPKSQPTTPQETVTGK
LFGFGASIFSQASNLISTAGQPGPHSQSGPGAPTKQAPVPSQPPTSQGPPKSTGQAPPAP
AKNIPVKKETKAPAAEKLEPKAEQAPTVKRTETEKKPPPVKDSKSLAAEPQKAVLPTKLE
LSPKPESTCPLCKTELNTGSTDPPNFNTCTECKNQVCNLCGFNPTPHLTEIQEWLCLNCQ
TRRAISGQLGDMSKMPPAPSGPKASPMPISTELPPQKTAVPPQVKVAKKEEQEVKTEAEK
VVLEKVKETISMENIPPMVTTDQKQEESKLEKDRASVLQEKTPLPEEKKLILKEEKVCPE
EKKPLLEEKKPTPEDKKLPPETKTSAPEEQKHDLLKSQVQIAEEKLEGGVTPKTVQEEKQ
PQTKMEDLPSGTPQLLPKEDNKTIKTIKEQPQPPCSAKPDQVEPGKEKTEKEDDKSDTSS
SQQPKSPQGLSDTGYSSDGISSSLGEIPSLIPTDEKDILKGLKKDSFSQESSPSSPSDLA
KLESTVLSILEAQASTLVDEKSEKKTKPHVVSSEQPKDHQKTQILSETLEITISEEGIKE
SQEERKDTFKKDSQQGIPSSKDHKEKSEFVDDVTTRREPYDSVEDSSESENSPVPQRKRR
TSVGSSSSDEYKQEDSQGSGEEEDFIRKQIIEMSADEDASGSEDDEFIRNQLKEISSSTD
NQKKEETKGKGKIAAGKHRRLTRKTSTSIDDDAGRRHSWHDEDDEAYDESPELKYRETKS
QESEELVVAGGGGLRRFKTIELNSTIADKYSAESSQKKTALFFDEEPELEMESLTDSPED
RSRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKKGESKQQRKARHRTHGPLLPTI
EDSSEEEELREEEELLKEQEKQREIEQQQRKSSSKKSKKDKDELRAQRRRERPKTPPSNL
SPIEDASPTEELRQAAEMEELHRSSCSEYSPSIESDPEGFEISPEKIIEVQKVYKLPTAV
SLYSPTDEQSVMQKEGSQKALKSAEEIYEEMMHKTHKYKAFPAANERDEVFEKEPLYGGM
LIEDYIYESLVEDTYNGSVDGSLLTRQEEENGFMQQRGREQKIRLSEQLYEDPMQKITDL
QKEFYELESLHSVMPQEDIVSSSFIIPESHEIVDLGTMVTSTGEEKKLLDADAAYEELMK
RQQMQLTPGSSPTQPTIGDDMTESTLDFDRMPDASLTSSVLSGASLTDSTSSTTLSIPDV
KITQHFSTEEIEDEYVTNYTREIQEIIAHESLILTYSEPSESATSVPPSDTPSLTSSVSS
VGTTDSSSPVTTLDSITTVYTEPVDIITKFEDSEEISSSTYFPGGIIDYPEEISVSFLDY
YTVGSPGLPSPPPPPLPPPTSPKPTIHPKKKLTVTAPVTTATPLFDAITTVETTAILRSN
GLPVTRIATTAPPPVPPKPSSIPSGLVFTHRPEPSKPPIAPKPVIPQLPTTTQKPTDIHP
KPTGLSLTSSMTLNLVTSADYKLPSPTSPLSPHSNKSSPRFSKSLTETYVVITLPSEPGT
PTDASASQVITSWPLGSPSKDLVSVEPVFSVVPPVTAVEIPGSSEQTLYISGALQTFSAT
PVTAPSSFQAAPTSVAQFLTTEVSKTEVSATRSTAPSVDLSSISITIPPEPLALDNLHLE
KPQYKEDGRLQLVGDVIDLRTVPKVEVKTTEKCIDLSASAMDVKRQITTNEVYGKQISAV
QPSIINLSATSSTVTPISLATETVTFVTCTASASYTPGTESLVGVEHVMATPLPLTTSKH
AEPPYRIPSDQVFPTVREEAPINLSLGTSAHAMTSAITKPVTVPPVGVTNGWTDSTISQG
ITDGEVVDLSTTKSHRTVVTMDESTSSVMTKIIEDDEKPVDLTAGRRAVCCDVVYKLPFG
RSCTAQQPATTLPEDRFGYRDDHYQYDRSGPYGYRGIGGMKPSMSDTNLAEAGHFFYKSK
NAFDYTEGTDTAVDLTSGRITTGEVMDYSSKTTGPYPETRQVISGVGISTPQYSTARMTP
PPGPQYCVGSVLRSSDGVVYSSVATPAPSTFAITTQPGSIFSTTVRDLSGIHTTDAVTSL
SALHHSQPMPRSYFITTGASETDIAVTSIDISASLQTITIESLTAETIDSVPTLTTASDV
FPEVVGDESALLIVPEEDKQQQQLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEK
IMVQKKLEELQSMKQHLLYQQEEERQAQFMMRQETLAQQQLQLEQIQQLQQQLHQQLEEQ
KIRQIYQYNYDPSGTASPQTTTEQAILEGQYAAPEGTQFWATEDATTTASGVVAIEIPQS
QGWYTVQSDGVTQYIAPPGILSTVSEIPLTDVVVKEEKQPKKRSSGAKVRGPYDEMGENM
ADDPRSFKKIVDSGVQTDDEDATDRSYVSRRRRTKKSVDTSVQTDDEDQDEWDMPTRARR
KARVGKYGDSMAEADKTKPLSKVSSIAVQTVAEISVQTEPVGTIRTPSIRARVDAKVEII
KHISAPEKTYKGGSLGCQTEADSDTQSPQYLSATSPPKDKKRPTPLEIGYSSHLRADSTV
QLAPSPPKSPKVLYSPISPLSPGKALESAFVPYEKPLPDDISPQKVLHPDMAKVPPASPK
TAKMMQRSMSDPKPLSPTADESSRAPFQYTEGYTTKGSQTMTPSGSQKKVKRTLPNPPPE
EISTGTQSTFSTMGTVSRRRICRTNTMARAKILQDIDRELDLVERESAKLRKKQAELDEE
EKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSSTRPTRIESQ
HGIERPRTAPQTEFNQFIPPQTQTESQLVPPTSPYTQYQYSSPALPTQAPTSYTQQSHFQ
QQTLYHQQVSPYQTQPTFQAVATMSFTPQAQPTPTPQPSYQLPSQMMVIQQKPRQTTLYL
EPKITSNYEVIRNQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIGLEERSSMASSPISSIS
ADSFYADIDHHTPRNYVLIDDIGEITKGTAALSTAFSLHEKDLSKTDRLLRTTETRRSQE
VTDFLAPLQTSSRLHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGTESLDHLAGLSHYYH
ADTGYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPKMSKFSPIQESR
DLEPDYSSYMTSSTSSIGGISSRARLLQDDITFGLRKNITDQQKFMGSSLGTGLGTLGNT
IRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSLRLKAQEAEALDVSFSH
ASSSARTKPTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGPLPPISADTRD
QFGSSHSLPEVQQHMREESRTRGYDRDIAFIMDDFQHAMSDSEAYHLRREETDWFDKPRE
SRLENGHGLDRKLPERLVHSRPLSQHQEQIIQMNGKSMHYIFPHARIKITRDLKDHTVSG
NGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLVEGMQVLEWNGIPLTSKTYEE
VQSIISQQSGEAEICVRLDLNMLSDSENPQHLELHEPPKTVDKAKSPGVDPKQLAAELQK
VSLQQSPLVLSSVVEKGSHVHSGPTSAGSSSVPSPGQPGSPSVSKKKHSSSKPTDATKVV
SHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNAS
AEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDL
SSTSHLDNTPRWYPLKEQTESIDHGKSHSSQGSQQSPKPSVIKSRSHGIFPDPSKDMQVP
TIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVTQTHLEDAGAAIAAAEAAVQQLRIQP
TKPPNHRPAESSVSTGSSGSSFGSGYSVDSEGSSSTAGETNLFPIPRIGKMGQNGQEPVK
QPGVGVGLADSEAKTQVMGEIKIALKKEMKTDGEQLIVEILQCRNITYKFKSPDHLPDLY
VKIYVMNISTQKKVIKKKTRVCRHDREPSFNETFRFSLSPAGHSLQILLFSNGGKFMKKT
LIGEACIWLDKVDLRKRIVNWHKLLVSPTQTH
NT seq 14859 nt   +upstreamnt  +downstreamnt
atgggcaacgaggcgagcttggaaggggaagggctccccgaagggctggcggcggccgca
gcggccggaggaggggctagcggggcggggagcccctcgcacaccgtgatcccggccggc
atggaggcggatttgagccagctgagcgaagaggagaggagacagatcgctgctgtcatg
tcaagggcgcaggggctgcccaaggaaagcgtccccccggccgctgcggagtcgccttcc
atgcacaggaaacaagagttggatagtagtcatcctccaaagcaatcaggaagaccccca
gaccctgggcgtccagctcagcctggtctcagtaaaagtagaactacagatactttcagg
tcagagcagaaattgcctgggaggagtccttccaccattagcttgaaagaatcaaagtcc
agaactgattttagggaagagcacaagtctagtatgatgcctggcttcctctcagaggtt
aaccctttaagtgctgtctcctctgttgtaaataaattcaacccttttgatttgatatca
gactctgaggcatcccaggaagaaatcaccaagaaacaaaaagtagttcagaaggagcaa
ggaaaacctgagggaatcacaaaacctccttcacaacagcagtcacccaagccagttcct
aagcagcaaggagctggtaaggatccacttcagcaggatggccctcccaaattggtatct
tctcaacaaccagaaaaaattaaatcacaacctcaaggtacaggaaagccaattcagggt
cctgctcagactcctcagacagaccaggcaaaattgtcacttcaacgagatgcatccagg
cctcagactaaacaggcagacatagtaaggggagaatcagttaaaccctcactacaaagc
ccatccaaaccacctattcagcaaccaagtcctaaaaaacctccagcacagcagcctgga
cctgaaaaatcacagcctgggcctgcaaagcctccagctcagcccccagggctaacaaag
ccactggctcaacaaccagggacggtgaaacccccagtgcagccaccaggaacaacaaag
cctccagctcagtctcttggtcctgctaagcctccagctcagcaaactgggtcagagaag
ccttcattggagcaacctgggccaaaggctctagctcagcctcctggagttggaaagact
ccagctcagcagccagggccaggaaagcctccaacccagcaggtggggacaccaaaacct
gtagctcaacaacctgggctacagtctccagccaaggcaactgggcctacaaagactcca
gtacagcagcctgggccaggaaagactccagctcaacaggcaggaccagcaaagccttct
gcccagcagactggcccaacaaagcttccttcacaacttcctggcccagcaaagccccca
cctcaacagcctggctcagcaaagcccccacctcaacaacctggctcagcaaaactccca
tctcaacagcctgggtcagcaaaacccttagctcaacaaccgagcccaacaaagccctca
gctcaacagtctacaaaaccagtaagccaaacaggatctgcaaaacccctgcagccacca
acaatgtctccatctgcaaaacagcctccatcacaaggcctccctaaaaccatctgtcct
ctttgcaataccactgaacttctgttgcatgttccagaaaaagccaattttaacaaatgc
actgagtgtcaaaccactgtctgtagcctctgtggatttaatcccaatcctcatttaacg
gaggtaaaagagtggctctgtttgaactgtcagatgaaaagagctctaggcggggatctg
gctccagttccatcatcaccccatcccaaaccgaagactgcacctgttacctcaacatca
gcagtgagcaaatcatccccacagtcacagcagacctccccgaagaaggatgctgcccca
aaacaggatgtctccaaggcacctgagcctaaaaagccaccaccactagtgaaacaacca
acccttcacggctctccttcagccaaggccaagcagcctcctgaggcagattcttcatct
aagccagcccctcccaaagaatcttctgtcccatctgagcaggacaaggcccctgtcgct
gatgataaaccaaagcagaccaagacagtaaagccacccacagaccttgtatcttcatca
tcagcaacaacaaaacctgatattccaagctccaaagtacagtcacaagctgaagagaaa
acaacccctcctctaaaaacagactctgccaaaccctcacaaagttttccaccaacaggg
gaaaaaatcaccccagttgactctaaagccatacctcgacctgcatcagattcaaaaatt
atttcacatcctgggcctagttcagagagcaaaggtcaaaaacaagttgacccagttcaa
aagaaggaagaacccaagaaagcacaaaccaaaataactcctaaaccagatgccaagcca
gtgccaaaagggtcaccaacaccccctagcccacgacctaccactggccaaactgtcccc
acacctcaacagcccccaaagtctcaggagcagtcaagacgtttcagtctgaatctggga
agtattactgatgcccccaaatcacagcctacaactcctcaagagaccgtgactgggaaa
ctctttgggtttggagcatcaatcttcagccaggcatcaaatttaatttccactgcaggc
caacctggacctcattcacaaagtggaccaggggccccaacgaaacaagcccctgtccct
tcacagccacctacttcgcaagggccacccaaatccacaggtcaagcaccaccagcgcct
gcaaagaatatacctgtgaaaaaggaaacaaaagccccagcagctgaaaaattagagccc
aaagctgaacaagctccaacagtaaaacgaacagaaacagaaaaaaagcctccacctgtt
aaggatagcaaatctttagcagctgagcctcaaaaggctgtccttcccacaaaactggag
ctttctcccaaaccagaatcaacctgtcctctctgcaaaactgaactcaacacaggttct
acggatcctcctaacttcaatacttgcactgaatgcaagaatcaagtgtgtaatctttgt
ggatttaaccctacaccacatctgactgagattcaagaatggctttgtttaaattgccaa
acccggagagcaatatcaggacagcttggagacatgagcaaaatgccacctgcaccatca
gggcccaaagcatctcccatgcctatctctacagaactaccacctcagaaaacagcagtg
cctccccaagtaaaagtagcgaaaaaggaggaacaagaagtaaaaacagaagctgaaaaa
gtcgttctagaaaaagtaaaggaaacaatatcaatggaaaacattccccctatggtaacc
acagatcaaaaacaagaagagagtaagctagagaaagacagagcttcagttcttcaagaa
aaaacgccactccctgaagaaaaaaaactaatcctgaaagaagaaaaggtatgtcctgaa
gaaaaaaagccactcttagaagaaaaaaaaccaacccctgaagacaaaaagctaccacca
gagacaaaaacatcagccccagaagaacaaaaacatgacttacttaaatctcaagtacaa
attgctgaagaaaagctggaaggcggagtgactccaaagacagtgcaagaagagaaacaa
ccacagaccaagatggaagatttaccctctggcacacctcagcttttacctaaagaagat
aataagacaatcaaaacaataaaagaacagccacagccaccatgctcagcaaagcctgat
caggtggaacctgggaaagaaaaaacagaaaaggaagatgacaaatcagacacctcaagt
tctcagcagcctaaaagccctcaaggtctgagtgacacaggatattcttctgatggaata
tcaagctcacttggtgaaattccaagtcttattccaactgatgaaaaggatattctcaag
ggactaaaaaaggactctttttcacaagaaagcagcccttccagcccctcagatttggct
aagttagaaagtacagtcctatccattttggaagctcaagcaagtacacttgttgatgaa
aagtcggaaaagaaaacaaaaccccatgtggtttcttcagaacagcctaaagaccatcag
aaaacacagattttatctgaaaccttggaaattactatttcagaagaggggatcaaagaa
agtcaagaagaaaggaaagacacatttaaaaaagatagccaacaaggtattccttccagc
aaggaccataaagaaaagtctgagtttgttgatgatgtaactactagaagagagccttat
gattctgttgaagacagtagtgaaagtgaaaactcacctgttccacaaagaaaacgaaga
actagtgttggctcatcaagcagtgatgaatataaacaggaagacagccaaggatcaggg
gaagaggaggatttcattcgaaaacaaatcatagaaatgagtgctgatgaagacgcttca
ggttctgaagatgatgagttcatcaggaaccagctcaaagagattagtagcagtactgat
aaccagaaaaaggaagaaacaaagggaaaaggcaaaatagcagcagggaaacacagacga
ctgactcgaaaaactagcacaagcattgatgatgatgcaggaagacgtcactcatggcat
gatgaagatgatgaagcatatgatgaaagtcctgaacttaaatacagagaaactaaaagt
caggaaagtgaagaacttgtagttgctggaggaggagggctacgccgatttaaaacaatt
gagctcaatagtacaatagcagataaatattctgcagagtcatcacagaaaaaaacagct
ttgttttttgatgaagagccagaattagaaatggaaagcctgacagactcacctgaagat
aggtcaaggggagagggatcttctagtcttcatgcgtccagctttactcctggtacatcc
cctacatcagtatcatcacttgatgaggacagtgacagtagcccgagtcacaaaaaagga
gagagcaaacagcaacgcaaagctcggcacagaacacatggccctcttttgcctactatt
gaagattcttcagaggaagaagaattgagagaggaagaagaattattaaaggagcaagaa
aaacagagggaaatagaacagcaacaaagaaagagttctagtaaaaaatcaaagaaagac
aaagatgaacttcgagctcagagaagaagggaaagaccaaagacaccacctagtaatctc
tctcctattgaagatgcatctccaacagaagagttacgtcaggccgcagaaatggaggag
ctccatagatcttcttgttctgaatattcacctagcatagaatcagacccagaaggtttt
gaaataagcccagaaaaaataatagaagtacaaaaagtttataaattgcccacagctgtg
tcattatactcaccaacagatgagcaatctgttatgcagaaagaaggtagccaaaaggca
ttaaaaagtgctgaggagatatatgaagaaatgatgcataaaacacacaaatataaagct
tttccagctgcgaatgaacgagatgaagtgtttgaaaaagagcctttgtacggtggcatg
ctaatagaagattatatttatgaatccttagtagaagacacatataatggatcagtagat
ggaagtctgctaacaaggcaagaagaagaaaatggatttatgcagcaaagaggaagagag
caaaagataagactttcagaacagctttatgaagatccaatgcagaaaattacagatctg
caaaaagaattttatgagttagaaagcttacattctgttatgcctcaagaagatattgtt
tcaagctcttttatcatcccagaaagccacgagatagtggatctgggtactatggtaact
tctacaggagaagaaaaaaaactactagatgctgatgctgcctatgaagaacttatgaag
aggcaacagatgcagttaacacctggatccagcccaacccaacccaccattggtgacgat
atgacagagtccaccttggactttgatagaatgcccgatgcatctttgacatcaagtgtt
ctctcaggagcatctcttacagattcaaccagcagtacaacactctctatcccggatgtt
aaaataacccaacatttttcaacagaagaaattgaggatgaatatgtaaccaattataca
agagaaattcaagagataattgcccatgaatcactgattttgacctattcggagccttca
gaaagtgctacatctgtcccaccctctgacacaccttctctcacatcatctgtttcttcc
gtcggtaccactgatagctcctcacctgttactaccctggatagcataaccacagtttat
acagagccagtggacataataactaaatttgaagattcagaggaaatttcttcatcaact
tattttccaggcggcattatagactatccagaagaaataagtgtgtcttttttggactac
tacaccgtgggatccccgggccttccatcccctcctcccccaccacttcctccaccaact
tcacctaaaccaactattcatcctaaaaaaaagttaacagttacagctccagtgactaca
gctacacctctgtttgatgctattactactgtagagaccacagctattctgagaagtaat
ggattacctgtaacaagaatagctaccactgcacctcctcctgttcctcctaagccatct
tcaattccatctggacttgtatttacccataggcctgagccaagcaaacctccaatcgcc
cccaagccagtgattcctcagcttccaacaactacacaaaaaccaacagatatacatccc
aaaccaacaggtctatctttaacttcaagtatgaccttaaatttagtgacttcagcagat
tataaattgccttcccctacctccccactttccccacactccaacaagtcctcaccgaga
ttttccaaatccctcacggaaacgtatgtagttattacattgccatccgaacctgggact
ccaacagatgcttcagctagtcaagttattaccagttggcccttgggatcaccctccaaa
gatctggtttctgttgaaccggtgttttctgtagttcctcctgtgacagctgtagaaatt
ccaggttcttcagaacagaccctgtatatctctggagctttgcagacattttctgccacc
cctgtcacagcaccctcttcatttcaagcagctcccacatcagttgcacagtttctcaca
actgaagtttccaagactgaggtttcagcaaccagaagtacagctcctagtgttgatctc
agcagcatttccataacaattcctccagagcctcttgctctagataacctacatttagag
aagcctcagtataaagaagatggaagactgcaacttgttggtgatgtaattgatttgcgt
acagtaccaaaagtagaagttaaaacaactgaaaaatgtatagatctttctgcttctgca
atggatgtgaaaagacagattacaacaaatgaagtttatgggaaacaaattagtgctgtc
caaccctctattataaatcttagtgcaacatcatcaacagtgactcctatatctctggcc
actgagacagtgacctttgttacatgcacagctagtgcaagttacactccaggcacagaa
agcctagtgggtgtggaacatgtaatggcaacaccactcccacttacaacatcaaagcat
gctgagcccccatataggataccaagtgaccaggtcttccctacggttagggaagaagcg
ccaataaacttatctctaggtacttcagcacatgcaatgacatcggctattacaaaacct
gtcactgtgcctcctgttggtgtcacaaatggatggactgatagcaccatatcccagggg
atcactgatggggaagtagtggatctcagcacaaccaagtctcatagaacagttgtaaca
atggatgaatctacttcaagtgtgatgaccaaaataatcgaagatgacgaaaaacctgtt
gatttgactgcaggaagaagagctgtgtgctgtgatgtggtttataaattaccattcgga
aggagctgcacagcacagcagcctgcaactactcttccggaggatcgttttggttacagg
gatgaccactatcagtatgatcgatcagggccatatggttatagagggattgggggaatg
aagccttccatgtctgacacaaatttagcagaagctggacattttttctataaaagtaag
aatgcttttgattatactgaaggaactgatacagcagtagatctgacttcagggagaatt
actacaggtgaggtaatggattattcaagcaagaccacaggtccatatccagaaacaaga
caagtcatttcaggagttgggattagtaccccacagtattccacagcaaggatgacacca
ccgccaggaccccagtattgtgtggggagtgttttgaggtcatctgatggtgttgtctat
tcttcagtagcaactccggcaccctctacgtttgctatcaccacacaacccggctccatt
ttcagcaccacagtgagggatttgtctggtattcatacaactgatgccgtgacttcatta
tctgcccttcaccatagccagccaatgcctagatcatattttataacaacgggtgcatca
gaaacagacattgcagtaactagtattgatatcagtgccagtttgcaaactattactatc
gaatctcttactgctgagacgatagactccgttcccactttaaccacagcatccgatgtg
tttcctgaagtggtgggagatgaaagtgctcttttaattgtccctgaagaagataaacaa
cagcagcagctagacttggagcgtgagctcctggaactggagaaaattaagcaacagcgc
tttgctgaggaattggagtgggaacgtcaggaaattcaaagattccgagaacaagagaag
atcatggttcagaaaaagctggaggagctgcagtctatgaagcagcaccttctctatcag
caagaagaagagcggcaagcccagttcatgatgaggcaggagacgttagctcagcaacag
ttacagcttgagcagatccaacagctgcagcaacaacttcaccagcagctggaggagcaa
aagattcgccaaatctaccagtataactatgacccttctggaactgcttctccacaaacc
actacagagcaggcaattttggaaggtcagtatgctgccccagaagggactcaattttgg
gcaactgaagatgcaaccaccacagcctcaggtgttgtggcaattgaaataccacagagc
caaggatggtacactgttcagtctgatggtgtcacccagtacattgccccacctggtatc
ctgagcactgtttcagaaatacctctaacagatgttgttgtgaaagaggaaaaacaaccc
aaaaagagaagttctggagctaaagtccgaggaccatatgatgagatgggagaaaatatg
gcagatgatccccgaagttttaaaaagatagtggacagtggtgtacaaacggatgacgaa
gatgccacagatcggagctatgtgagtagaagaaggagaactaaaaagagtgtggataca
agcgtccaaactgatgatgaagatcaggatgagtgggatatgcctactagagcaaggagg
aaagctcgtgtagggaaatatggtgacagcatggcagaggctgacaagaccaaacccctt
tccaaagtctccagcatagcagttcaaacggtagcagagatatctgtgcaaactgaacca
gttggaaccataagaacaccctccatacgggcacgagtggatgccaaggtagaaataatt
aaacacatttcagcacctgaaaagacttacaaagggggcagtttaggatgtcaaacagaa
gcagattcagacacacaaagtcctcaatatctgagtgccacatctccacccaaagacaag
aaacgcccaacacctttagagattggttattcatctcacctccgagcagattccacagta
cagctggctccttccccacccaaatcccccaaagtcctttattcacccatctcaccactt
tcaccaggcaaagccttagaatcagcctttgtaccttatgaaaaacccctccctgatgat
ataagtccacagaaagtactgcatccagatatggctaaagttcccccagcaagtcctaag
acagccaagatgatgcagcgttctatgtctgaccccaagcctctgagtccaacagcagac
gaaagttccagggctccttttcagtataccgagggctatacgactaaaggttctcaaacc
atgacaccctctggatcccagaaaaaagttaaaaggactctgccaaatccgcctcccgag
gagatttccacaggaactcaatccacattcagcacaatgggcacagtttccaggagaagg
atctgcagaaccaataccatggcaagagccaagattctccaggacatagaccgagagctt
gatcttgtggaaagggaatctgcaaagctcagaaagaaacaagcagagcttgatgaagaa
gaaaaggagattgatgccaagctacgatacctggaaatgggaattaacaggaggaaagag
gcattattaaaggagagagaaaagagagaacgagcctatctccagggggtagctgaggat
cgtgattacatgtctgacagtgaagtgagcagcacaagaccaacccgaatagaaagtcag
catggcattgagcgaccaagaactgctcctcaaactgaattcaaccagtttataccacca
caaacccaaacagaatctcaactagttcctccaacaagtccttacacacaatatcaatac
tcttcccctgctcttcctacccaagcacccacctcatacacccaacagtctcatttccag
caacaaactttgtaccaccagcaagtttcaccttatcagactcagccaacattccaagct
gtggcaacaatgtccttcacacctcaagctcaacctacaccaaccccacagccttcttat
cagttaccttcacagatgatggtgatacaacagaagccacgccaaactacgttatatttg
gagcccaagataacctcaaactatgaagtaattcgcaaccaaccccttatgatagcacct
gtttctactgataatacatatgctgtttcccatcttggtagtaagtacaatagtttagac
ttgagaataggtttggaggaaagaagtagcatggcaagcagtccaatatcaagcatatct
gcagattctttctatgcagatattgatcaccatactccacgaaattatgtcctaattgat
gacattggagagatcaccaaaggaacagcagcattaagcaccgcatttagccttcatgag
aaggatctgtcaaaaacagaccgtctccttcgaactactgaaacacgccggtctcaagaa
gtgacagatttcctagcacctttacagacttcctctagattgcatagttatgtgaaggca
gaggaagacccaatggaggatccttatgagttaaagcttctgaaacatcagattaaacag
gaatttcgtagagggacagagagcttagatcaccttgctggtctttctcattattaccat
gccgatactggctatcgacattttccaaaatctgaaaagtatagcatcagtagactcacg
cttgaaaaacaagcagcaaaacaactgccagcagccatactttatcaaaagcagtcaaag
cataagaaatcactaattgaccctaaaatgtcaaaattttcacctattcaagaaagtaga
gatcttgaacctgattattcaagctatatgacttctagcacttcatctattggtggcatt
tcttccagggcaaggcttcttcaagatgacatcacttttggtctcagaaaaaatattaca
gaccaacaaaaatttatgggatcctctcttggcacaggactgggcacattaggaaatacc
atacggtcagctctgcaggatgaagcagataagccatacagtagtggcagcaggtccaga
ccttcctctagaccttcttctgtctatgggcttgatttatcaattaaaagagattcttct
agctcttccctaagactgaaagctcaagaggctgaagctctagatgtttcctttagtcat
gcatcatcctctgccagaactaagccgaccagtttgccaatcagtcaaagtagaggaaga
ataccaattgtggcccagaattctgaagaagaaagcccactcagtcctgttggccagcca
atgggaatggccagggctgcagccggacccctgccaccaatatctgcagacactagggat
cagtttggatcgagccactcattgcctgaagttcagcaacacatgagggaagaatcacgg
actcgaggctatgaccgtgacatagcattcatcatggatgacttccaacatgccatgtca
gacagtgaagcctatcatctgcgtcgtgaggaaacagattggtttgataaacccagggag
tctcgtttggaaaacggacatggtctggaccgaaaactgcccgaaagattggtccactct
agaccactcagtcaacatcaagagcaaattatacagatgaatgggaaaagtatgcactac
atctttcctcatgcaaggataaaaataacaagagacttaaaggatcacacagtttcaggt
aatggattaggaattagaattgtgggtggtaaagaaatccctggacatagtggagaaatt
ggagcctatattgccaagattcttcctgggggaagtgcggaacagacagggaaacttgtg
gaagggatgcaagtattggaatggaatggaattcccttaacttctaaaacatatgaagaa
gttcagagtatcattagtcagcaaagtggggaagcagaaatatgtgtaagactggacctc
aatatgctatcagattctgaaaacccccagcatctggaacttcatgagccaccaaaaact
gtggataaggcgaaatccccaggggttgatcctaagcaattggcagccgaactccagaag
gtttcactacagcagtcaccactggttctgtcgtcagttgttgaaaaaggatctcatgtt
cattcaggtcctacatcagcaggatccagttctgttcccagccctgggcaaccagggtcc
ccctcagtgagcaaaaagaagcacagcagcagcaagcctactgatgcaacaaaggtggtc
tctcatccaattacaggagagattcagcttcaaattaactatgatcttggaaatctcata
atacatattctccaagcaagaaatctcgttcctcgagacaacaatggttattctgaccct
tttgtgaaagtgtaccttcttccagggagaggtcaagtcatggttgtccagaatgcaagt
gctgagtacaagagaaggactaaatatgttcagaaaagtcttaatcctgagtggaatcaa
acagtaatttataaaagtatttccatggaacagctcaagaagaaaacactggaggtgaca
gtttgggattatgatagattttcatccaacgactttcttggggaggtattgattgattta
tctagcacatctcacctcgataacactccaaggtggtatcctctcaaagaacagactgaa
agcattgatcatggcaagtctcattccagtcagggcagccagcagtctccaaagccatct
gttataaaaagcagaagccatggtatcttccctgacccatcaaaggacatgcaggttccc
accattgagaaatcccatagtagtcctggtagctcaaaatcatcatcagaaggccatctc
cgttctcatggaccctctcgcagtcaaagcaaaaccagcgtcactcaaacccacctggaa
gatgcaggggctgccatagctgctgccgaagccgccgtgcaacaactccgcattcaacca
acaaagcctcccaatcaccggcctgcagaaagctctgtgtccaccggctcctcgggcagc
agctttggcagtggatatagcgtggacagtgaaggaagcagcagcactgcaggggagact
aatctatttcctattccgaggatagggaagatgggacagaatggacaagagcctgtaaaa
cagccaggggtaggagtaggactagcagactcagaagctaaaactcaagtaatgggagaa
atcaagattgcattgaagaaggaaatgaagacagatggtgaacaactaatagttgaaatt
ctccaatgcagaaatattacatacaaatttaagtctcctgatcatctaccagatttatat
gtgaaaatatatgtgatgaatatttctacccaaaaaaaggtgatcaagaaaaaaacaaga
gtatgcagacatgatcgagagccttcattcaatgaaacttttcgattcagtctaagtcct
gcaggacattctcttcagattttacttttctccaatggaggaaagtttatgaaaaagacc
ttgattggtgaagcctgtatctggcttgacaaagtggatctcagaaaaagaatagtcaac
tggcacaaacttttggtcagtcctactcaaacacattga

DBGET integrated database retrieval system