KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388914Help
Entry
100388914         CDS       T03264                                 

Gene name
ZMYM3
Definition
(RefSeq) zinc finger MYM-type containing 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-FCS DUF3504 YHS Arc_trans_TRASH
Motif
Other DBs
NCBI-GeneID: 100388914
NCBI-ProteinID: XP_008987712
Ensembl: ENSCJAG00000013481
UniProt: U3FMU0
LinkDB All DBs
Position
X
AA seq 1371 aa AA seqDB search
MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLL
DTPAGLEKDPEVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQT
PEVVPPDPGAGANSSSPEGLLEPLAPDSPITLQSPHIEEEETTSMATARRGSPGQEEELP
QGQPQSPNAPPSPSVGETLGDGINTSQTKPGGSSPAAHPSLPGDGLTAKASEKPPERKRS
ERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVSQRA
GRSAVGTKMTCAHCRTPLQKGQTAYQRKGLPQLFCSSSCLTTFSKKPSGKKTCTFCKKEI
WNTKDSVVAQTGSGGSFHEFCTSVCLSLYEAQQQRPIPQSGDPADATRCSICQKTGEVLH
EVSNGSVVHRLCSDSCFSKFRANKGLKTNCCDQCGAYIYTKTGSPGPELLFHEGQQKRFC
NTTCLGAYKKKNTRVYPCVWCKTLCKNFEMLSHVDRNGKTSLFCSLCCTTSYKVKQAGLT
GPPRPCSFCRRSLSDPCYYNKVDRTVYQFCSPSCWTKFQRTSPEGGIHLSCHYCHSLFSG
KPEVLDWQDQVFQFCCRDCCEDFKRLRGVVSQCEHCRQEKLLHEKLRFSGVEKSFCSEGC
VLLYKQDFTKKLGLCCITCTYCSQTCQRGVTEQLDGSTWDFCSEDCKSKYLLWYCKAARC
HACKRQGKLLETIHWRGQIRHFCNQQCLLRFYSQQNQPNLDTQSGPESLLNSQSPEAKPQ
TPSQTKVENSNTVRTPEENGNLGKIPLKTRSAPTAPTPPPPPPPPATPRKNKAAMCKPLM
QNRGISCKVEMKSKGSQTEEWKPQVIVLPIPVPIFVPVPMHLYCQKVPVPFSMPIPVPVP
MFLPTTLESTDKIVETIEELKVKIPSNPLEADILAMAEMIAEAEELDKASSDLCDLVSNQ
SAEGLLEDCDLFGPARDDVLAMAVKMANVLDEPGQDLEADFPKNPLDINPSVDFLFDCGL
VGPEDVSTEQDLPRTMRKGQKRLVLSESCSRDSMSSQPSCTGLNYSYGVNAWKCWVQSKY
ANGETSKGDELRFGPKPMRIKEDILACSAAELNYGLAQFVREITRPNGERYEPDSIYYLC
LGIQQYLLENNRMVNIFTDLYYLTFVQELNKSLSTWQPTLLPNNTVFSRVEEEHLWECKQ
LGVYSPFVLLNTLMFFNTKFFGLQTAEEHMQLSFTNVVRQSRKCTTPRGTTKVVSIRYYA
PVRQRKGRDTGPGKRKREDEAPILEQRENRMNPLRCPVKFYEFYLSKCPESLRTRNDVFY
LQPERSCIAESPLWYSVIPMDRSMLESMLNRILAVREIYEELGRPGEEDLD
NT seq 4116 nt NT seq  +upstreamnt  +downstreamnt
atggaccccagtgatttccccagtccatttgacccattgaccctgccagagaagcccctg
gctggagatctaccagtagacatggaatttggagaggatctgctggaatcccagactgcc
ccaactcgaggatgggccccccctggcccttctccatcctcgggagccctggacctgctt
gatacccctgctggcctggaaaaagaccctgaagtcctggatggagccactgagttgctg
gggctgggggggctgctctataaagccccctctcccccagaggtggaccatggtcctgag
gggaccctggcatgggatgcaggggatcagaccctagagcctggaccggggggccagacc
cctgaggtggtaccacctgacccaggggctggggcaaattcttcttcacccgaggggctg
ctagagcctttggctccagattctccaataaccctacagtccccacatattgaagaagag
gagaccacctccatggctactgcgagaaggggctcccctgggcaggaggaggagcttccc
caagggcagccacagagcccaaatgccccccctagcccttcagtgggagagactctgggg
gatggaatcaacacttctcagaccaaacctgggggctctagcccggctgcacatccttcc
ttgccaggagatggcctgactgcgaaggcgagtgagaagccgcctgaacggaagagaagc
gagcgcgttaggagagcagaacctccaaaacctgaggttgtggattccactgagagcatt
ccagtgtcagatgaggattctgatgccatggtagatgaccccaatgatgaggactttgtg
ccattccggccccggcgctctcctcgaatgtccctacgttcaagtgtgtcacaaagggct
gggcgctctgcagtgggcaccaagatgacttgtgcacattgccggacaccactgcagaag
gggcagactgcctatcagcgcaaggggctgcctcagctcttctgctcgtcatcctgcctc
actactttctccaagaagccttcgggcaaaaagacctgtaccttctgcaagaaggagatc
tggaacaccaaggactcggttgtggcgcagactggttccggaggctccttccatgagttc
tgtacgtctgtctgtctctccctgtatgaggcccaacagcagcgcccgatcccccagtct
ggggatcccgcggatgccactcgctgcagcatatgccagaagactggagaggtcctgcat
gaggtcagcaatggcagcgtggtgcaccgactctgcagcgattcttgcttctccaaattc
cgggccaacaaaggactgaaaaccaactgttgtgaccagtgcggggcttacatctacacc
aagaccgggagccctggccccgagctcctcttccacgagggccagcaaaagcggttctgc
aacacaacctgcttgggggcgtacaagaagaaaaacacacgtgtgtacccatgtgtctgg
tgcaagaccctgtgtaagaactttgagatgctatcacatgtggatcgtaatggcaagacc
agcttgttctgttccctgtgctgtaccacttcttacaaagtgaagcaggcagggctcact
ggccctccccgaccctgcagcttctgccgccgcagcctctctgacccctgttactacaac
aaggtggaccgcacagtctaccagttctgcagccccagctgctggaccaagttccagcgc
acaagccctgaggggggcattcacctgagctgtcactactgccacagcctcttcagtggc
aagcctgaggtcttggactggcaggaccaggtgttccagttctgctgccgtgattgttgt
gaggacttcaagcggcttcggggtgtggtgtcccagtgtgagcactgtcggcaggagaaa
ctgttgcatgagaaactccgattcagcggagtggagaaaagcttctgcagtgaaggctgt
gtgctgctatacaaacaggacttcactaagaagctgggcttgtgctgtatcacttgtact
tactgctcccagacttgccagcgcggagtcactgagcaactggatggcagcacttgggac
ttctgcagtgaagactgtaagagcaagtacctgctgtggtactgcaaggctgcccggtgc
catgcctgtaagcgccaggggaagctgctggagaccatccactggcgtgggcaaatccgt
catttctgcaaccagcagtgtctgctgcgcttctacagccagcagaaccaacccaacctg
gatacccagagtgggcccgagagcctcctgaacagtcagtctcctgaggcaaaaccccag
acaccctctcaaaccaaagtggagaacagcaacacagtgaggactccagaggaaaatggg
aatttgggcaagattcctctgaagacccgatcagctcccactgctcccacccctcctcca
cccccgccgcccccagcaacaccccgcaaaaacaaagctgccatgtgtaagccgctgatg
cagaatcggggcatctcctgcaaggtggagatgaagtccaaagggagtcagacagaagag
tggaagccacaggtgatcgtgctgcccatcccagtgcccatctttgtgccagtgcctatg
catctgtactgccagaaagtcccagtgcctttctcaatgcctatcccggtgcctgtgccc
atgttcttgcccactaccttggagagcacagacaagattgtagagaccattgaggagctg
aaggtgaagatcccttccaaccccttggaggctgacatcctggctatggcagaaatgatt
gcagaggctgaggagttagacaaggcctcatctgacctttgtgatcttgtgagcaaccag
agtgcagagggactcctggaagactgtgacctgtttgggcctgctcgagatgatgtcctg
gccatggcagtcaagatggccaacgtcttggatgagcctgggcaagacttggaggcagac
tttcctaagaatcctttggacattaatcccagtgtagacttcctctttgattgtggcctg
gtagggcctgaggacgtgtctactgaacaagaccttccccgaaccatgaggaagggtcaa
aagcggctggtgctttccgaaagctgttctcgggactccatgagcagtcagcctagttgt
actggactcaactattcttatggtgtcaatgcttggaagtgctgggtgcagtcaaaatat
gccaacggagaaaccagcaagggtgatgagctgcgctttggccccaaacccatgcgtatc
aaagaggatattcttgcctgctcagctgctgaactcaactacggtctggcccaatttgtg
agagaaatcactcgacccaatggtgaacgatatgaacctgacagtatctactatctgtgt
cttggcatccagcagtatttgctggaaaataaccggatggtgaacattttcacggacctt
tactacctgacttttgttcaagaactcaacaagtctctgagtacctggcagcctacactc
ctccccaacaatacagtgttctctcgagtggaggaggagcacctctgggagtgtaagcaa
ctgggggtctactcgccctttgtcctcctcaacaccctcatgttcttcaacactaagttt
tttgggctgcagacagctgaggaacacatgcagctctccttcaccaatgtggtgcggcag
tcccgcaagtgtaccacccctcggggcaccaccaaggtggtgagcatccgctactatgcc
ccagtccgccagaggaaagggcgagacacaggtcctggaaaacggaagagagaagatgaa
gcccctatcttagagcagcgtgagaaccgcatgaatcccctccgctgccctgtcaagttc
tatgaattctatctctcaaaatgtcctgaaagcctccggactcgcaacgatgtgttctat
ctgcaacctgaacggtcctgcatcgccgagtcacctctctggtattctgtgatccccatg
gaccgcagcatgttggagagcatgctcaatcgcatcctggctgtgcgtgagatttatgag
gaactgggtcgtcctggggaggaagacctggactga

DBGET integrated database retrieval system