KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389088
Entry
100389088         CDS       T03264                                 

Gene name
MMP14
Definition
(RefSeq) matrix metallopeptidase 14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04668  TNF signaling pathway
cjc04912  GnRH signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100389088 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100389088 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    100389088 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjc01002]
    100389088 (MMP14)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     100389088 (MMP14)
Peptidases and inhibitors [BR:cjc01002]
 Metallo peptidases
  Family M10
   100389088 (MMP14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Metallopep DUF4953 Peptidase_M54 Peptidase_M66 HTH_17 Reprolysin_3 SKG6 Reprolysin_4
Other DBs
NCBI-GeneID: 100389088
NCBI-ProteinID: XP_002753656
Ensembl: ENSCJAG00000008538
UniProt: F7DBK0
LinkDB
Position
10
AA seq 582 aa
MSPAPRPSRCLLLPLLMLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPKS
FSEAIAAMQKFYGLQVTGKADADTIKAMRRPRCGVPDKFGAEIKANVRRKRYAIQSVKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAIRVWESATSLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSSPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTLGNANLDGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPYYQWMDTENFVLPDDDRRGIQQLYGSESGSPTKIPPQSWTT
SRPSVPDKPKKPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPLPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPAGGRPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAIFFFRRHGTPRRLLYCQRSLLDKV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtctcccgccccacgaccctcccgttgtcttctgctccccctgctcatgctcggcacc
gcgctcgcctccctcggctcggcccaaagcagcagcttcagccccgaagcctggctacag
cagtatggctacctgcctcctggggacctacgtacccacacacagcgctcacccaagtca
ttctcagaggccatcgctgccatgcagaagttctacggcttgcaagtaacaggcaaagct
gacgcggacaccataaaggccatgaggcgcccccgatgtggtgttccagacaagtttggg
gctgagatcaaggccaatgttcgaaggaagcgctacgccatacagagtgtcaaatggcaa
cataatgaaatcactttctgcatccagaattacacccccaaggtgggcgagtacgccacc
tacgaggccattcgcaaggcgatccgagtgtgggagagcgccacatcactgcgcttccgt
gaggtgccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttc
tttgccgagggcttccatggcgacagctcacccttcgatggtgagggcggcttcctggcc
catgcctacttcccaggacccaacattggaggggacacccactttgactctgccgagcct
tggactcttgggaatgcgaatctggatggaaatgacatcttcctggttgctgtgcacgag
ctaggccatgccctggggctcgagcattccaatgacccctcggccatcatggcaccctat
taccagtggatggacacagagaactttgtgttgcctgatgatgaccgccggggcatccag
caactttatgggagtgagtcagggtctcccaccaagataccccctcaatcctggaccacc
tcccggccttctgttcctgataagcctaaaaaacccacctatgggccgaacatctgtgat
gggaactttgacaccgtggccatgctccgaggggagatgtttgtcttcaaggagcgctgg
ttctggagggtgaggaataaccaagtaatggatggatatccattgcccattggccaattc
tggcggggactgcctgcgtccatcaacactgcctatgagaggaaggatggcaaattcgtc
ttcttcaaaggagacaagcattgggtgtttgatgaggcatccctggaacctggctacccc
aagcacattaaggagctgggccgagggctgccaaccgacaggattgatgctgctctcttc
tggatgcccaatggaaagacctacttcttccgaggaaacaagtactaccgtttcaacgag
gagctcagggcagtggacagcgagtaccccaagaacatcaaagtctgggaagggatcccg
gagtctcccagagggtcattcatgggcagcgatgaagtcttcacttacttctacaaggga
aacaaatactggaaattcaacaaccagaagctgaaggtggaaccgggctaccccaagtca
gccctgcgggactggatgggctgcccggcgggaggccggccagatgaggggactgaggag
gagacggaggtgatcatcattgaggtggacgaggagggcagcggggcagtgagtgcagct
gccgtggtgctgcccgtgctgctgctgctcctggtgctggcggtgggccttgcaatcttc
ttcttcagacgccatgggacccccaggcgactgctctactgccagcgttccctgctggac
aaggtctga

DBGET integrated database retrieval system