KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389500
Entry
100389500         CDS       T03264                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04530  Tight junction
cjc04622  RIG-I-like receptor signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04912  GnRH signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100389500 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100389500 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100389500 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100389500 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100389500 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    100389500 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100389500 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100389500 (MAP3K1)
   05161 Hepatitis B
    100389500 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100389500 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100389500 (MAP3K1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100389500 (MAP3K1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE11 family
   100389500 (MAP3K1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100389500 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD Phostensin_N APH FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 100389500
NCBI-ProteinID: XP_017821026
LinkDB
Position
2
AA seq 1760 aa
MAAAAGNRASSSGFPGAGAASPEAGGGGGALKASSAPAAAAGLLREAGSGDRERADWRRR
QLRTSTECGAGPAAGAAALPPRPGRGGDLGGGQRAMNECRAPCTASRGSERRDYGPLAGT
RAPEHPPTPPESGGAPDPAWGTGRVRAEEFVIVCRHVTGVRAALREPVAKRCGGPRLALW
DSRNRGSPRSPGGGARPCGGAPGRVSPGPGHWGARPEPAAGGGRKRGGVDGEPEVGWGTE
RAEEKAGGPRGRDRQSPSARSWLESLGRYRGPGPDAGGAPPAPAAGLGADGSVTPVKADR
MCQPFSFKAVVAAPRSPSGLALGPRRGCGASCSVPRRGPPAEFQGPHSTVGFGSDAYEVQ
LGIAFQLGQRVHLTRSQSNFGVWFYSNYPFCLFLEIIFHIYISHFLCFSLHFSREMENKE
TLKGLHKMDDRPEERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHL
AAESPGEAQASAASSASKGRRSPSPGNSPSGRPVKSESPGVRRKRVSPVPFQSGRITPPR
RAPSPDGFSPYSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCS
CGRGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTI
QKFVSRMSNSHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLH
HHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTIQQQPL
AGSQRRNQESNFNLTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRL
SHDVSGALLLANGESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCNVLSMVCADPV
YKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLL
ELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLE
FPAEFYPHIVSTDVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMV
TAVPHVFSKLLEMLSVSSSTHFTRMRRRLMAIADEVEIAEAIELGVEDNLDSQQDGFLQA
SVPSNYPETTENSSPECTIHLDKTGKGLCATKLSASSENISDRLASISLGPPSSTTTEQP
KPMVQTKGRPHSQCLNSSPLSHHSQLMFPALSTPSSSAPSVPAGTATDVSKHRLQGFVPC
KIPSASPQTQRKFSLQFQRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSK
QGDPSKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSI
EDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIA
MAMSASQDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLG
AFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGA
TCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKG
ANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDV
WSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQ
PQDRPPSRELLKHPVFRTTW
NT seq 5283 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccggggctgca
agccctgaggcgggcggcggcggaggggccctcaaggcgagcagcgcgcccgcggcggcc
gcgggactgctgcgggaggcgggcagcggggaccgcgagcgggcggactggaggcggcgg
cagctgcgcacaagtacggagtgtggagctggaccagctgccggagccgccgctcttcct
ccgcggccggggcgcggcggggacttggggggcgggcagagggcaatgaatgaatgccgg
gctccgtgcacggcgtcccggggctcagagcggcgagactacgggccgctcgccgggacc
cgcgcccctgagcaccccccgacccctccggagtcgggcggcgccccggacccagcctgg
gggaccggacgggtacgtgcagaagagtttgttattgtttgtagacatgtgacaggcgtg
cgagccgcgctgcgggaacccgtggcgaaaaggtgtggggggccacggctagctttgtgg
gactcccggaatcggggctctccgaggagcccggggggcggggcacggccctgcggcggc
gcccccggacgggtgtccccggggccggggcactggggggcgaggcccgagcctgcggcg
ggcggtggtcggaaaaggggcggggtggatggggagcccgaggtcgggtgggggacggag
agggccgaagagaaagcaggaggtccccgcggccgtgacaggcagagcccctcggcccgc
tcgtggctcgagtcgctaggcaggtaccgggggccgggcccggacgcgggcggcgcgccc
ccagcgcctgctgcagggctcggggcagacggctccgtaacgcctgtcaaagcggaccgg
atgtgtcagccattcagtttcaaagcagtagtggctgctccccgcagcccctccggcttg
gccctgggaccgcggcgcgggtgcggtgcttcctgctcggtgccgcggcgcgggccgcca
gctgaattccaggggccacacagcacggtgggcttcggctcagatgcatatgaagtacag
ctaggcatcgcatttcagcttggtcagcgtgtgcacctgactagaagccagtcaaatttt
ggtgtttggttttattcgaactatccgttctgtttgttcttggaaattatttttcatata
tacatttctcattttctttgcttctccctccattttagtcgtgagatggagaataaagaa
actctcaaagggttgcacaagatggacgatcgcccagaggaacgaatgatcagggagaaa
ctgaaggcaacctgtatgccagcctggaagcacgaatggttagaaaggagaaataggcga
ggccctgtggtggtaaaaccaatcccagtcaaaggagatggatctgaaatgaatcacttg
gcagctgagtctccaggagaggcccaggcgagtgcagcttcatcagcttccaaaggccga
cgcagtccttctcctggcaactccccatcaggtcgcccggtgaaatcagaatctccggga
gtaaggcgaaaaagagtttccccagtgccttttcagagtggcagaatcacaccaccccga
agagccccttcaccagatggcttctcaccatacagccctgaggaaacaaatcgccgtgtt
aacaaagtgatgcgggccagattgtacttactgcagcagatagggcccaactctttcctg
attggaggagacagcccagacaataaataccgggtgtttattggacctcagaactgcagc
tgtgggcgtggaacattctgtattcatctgctgtttgtgatgctccgggtgtttcagcta
gaaccttcagacccaatgttatggagaaaaactttaaagaattttgaggttgagagtttg
ttccagaaatatcacagtaggcgtagctcaaggatcaaagctccatctcgtaacaccatc
cagaagtttgtttcacgcatgtcaaattctcatacattgtcatcatctagtacttctaca
tctagttcagaaaacagcataaaggatgaagaggaacagatgtgtcctatttgtttattg
ggcatgcttgatgaagaaagtcttacagtgtgtgaagacggctgcaggaacaagctgcac
catcactgcatgtcaatttgggcagaagagtgtagaagaaatagagaacctttaatatgt
cccctttgtagatctaagtggagatctcatgatttctacagccatgagttgtcaagtcct
gtggattccccttcttccctcagagctgcacagcagcaaactatacagcagcagcctttg
gctggatcacagagaaggaatcaagagagcaattttaaccttactcattatggaactcag
caaatccctcctgcttacaaagatttagctgagccatggattcaggtgtttggaatggaa
ctcgttggctgcttattttctagaaactggaatgtgagagagatggccctcaggcgtctt
tcccatgatgtcagtggggccctgctgttggcaaatggggagagcactggaaactctggg
ggcagcagtggaagcagcccgagtgggggagccaccagtgggtcttcccagaccagtatc
tcaggagatgtggtggaggcgtgctgcaacgttctgtcaatggtctgtgccgaccctgtc
tacaaagtgtacgttgctgctttaaaaacgttgagagccatgctggtatatactccttgc
cacagtttagcagaaagaatcaaacttcagagacttctccggccagttgtagacaccatc
ctagtcaaatgtgcagatgccaatagccgcacaagtcagctgtccatatcaacattgttg
gagttgtgcaaaggccaagcaggagagttggcagttggtagagaaatactaaaagctgga
tccattggtattggtggtgttgattatgtcttaaattgtattcttggaaaccaaactgaa
tcaaacaactggcaagaactccttggccgcctttgtcttatagacagactgttgttggaa
tttcctgctgaattttatcctcatattgtcagtactgatgtttcacaagctgagcctgtt
gaaatcaggtataagaagctgctgtccctcttaacctttgctttacagtccattgataat
tctcactcaatggttggtaaactttccagaaggatctacttgagttctgcaagaatggtc
actgcagtaccccatgtgttttcaaaactgttagaaatgctgagtgtttccagttccact
cacttcaccaggatgcgtcgccgtttgatggctattgcagatgaggtggaaattgctgaa
gccatcgagttgggcgtagaagacaatttggatagtcaacaggatggctttttgcaggca
tctgtccccagcaactatccagaaaccacagagaacagttcccctgagtgtacaatccat
ttagacaaaactggaaaaggattatgtgctacaaaattgagtgccagttcagagaacatt
tctgacagactggccagcatttcactaggacctcctagttcaacaacaacagagcaacca
aagccaatggttcaaacaaaaggcagaccccacagtcagtgtttgaactcctctccttta
tctcatcattcccaattaatgttcccagccttgtcaaccccttcttcttcagccccatct
gtaccagctggcactgcaacagatgtctctaagcatagacttcagggattcgttccctgc
aaaataccttctgcatctcctcaaacacagcgcaagttttctctacaattccagagaaac
tgtcctgaaaacaaagactcagataaactttccccagtctttactcagtcaagacccttg
ccctccagtaacatacacaggccaaagccatctcgacctaccccaggtaatacaagtaaa
cagggagatccctcaaaaaatagcatgacacttgatctgaacagtagttccaaatgtgat
gacagctttggctgtagcagcaatagtagtaatgctgttatacccagtgatgagacagtg
ttcaccccagtagaggagaaatgcagattagatgtcaatacagagctcaactccagtatt
gaggaccttcttgaagcatctatgccttcaagtgatacaacagtaacttttaagtcagaa
gttgctgtcctgtctcctgaaaaggctgaaaatgatgatacctacaaagatgatgtgaat
cataatcagaagtgcaaagaaaagatggaagctgaagaagaagaagctttagcaattgcc
atggcaatgtcagcgtctcaggatgccctccccatagttcctcagctgcaggttgaaaat
ggagaagatatcatcattattcaacaggatacaccagagactctaccaggacataccaaa
gcaaaacaaccatatagagaagacactgaatggctgaaaggtcagcagataggccttgga
gcattttcttcttgttaccaggctcaagatgtgggaactggaactttaatggctgttaaa
caggtgacgtatgtcaggaacacatcttctgagcaagaagaagtggtagaagcattaaga
gaagagataagaatgatgagccatctgaatcatccaaacattattaggatgttgggagcc
acgtgtgagaagagcaattacaatctcttcatcgaatggatggcagggggatctgtggct
catttgctgagtaaatatggagctttcaaagaatcagtagttattaactatactgaacag
ttacttcgtggcctttcatatctccatgaaaaccaaatcattcacagagatgtcaaaggt
gccaatttactaattgacagcactggtcagagactaagaattgcagattttggagctgca
gccaggttggcatcaaaaggaactggtgcaggagagtttcagggacagttactggggaca
attgcgtttatggcacctgaggtactaagaggtcaacagtatggaaggagctgtgatgta
tggagtgttggctgtgctattatagaaatggcttgtgcaaaaccaccatggaatgcagaa
aaacactccaatcatcttgctttgatatttaagattgctagtgcaactactgctccatcg
atcccatcacatctgtctcccggtttacgagatgtggctcttcgttgtttagaacttcaa
cctcaggacagacctccatcaagagagctactgaagcatccagtctttcgtactacatgg
tag

DBGET integrated database retrieval system