KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389500
Entry
100389500         CDS       T03264                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04530  Tight junction
cjc04622  RIG-I-like receptor signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04912  GnRH signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100389500 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100389500 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100389500 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100389500 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100389500 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    100389500 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100389500 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100389500 (MAP3K1)
   05161 Hepatitis B
    100389500 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100389500 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100389500 (MAP3K1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100389500 (MAP3K1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE11 family
   100389500 (MAP3K1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100389500 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD Phostensin_N APH FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 100389500
NCBI-ProteinID: XP_017821026
LinkDB
Position
2
AA seq 1760 aa
MAAAAGNRASSSGFPGAGAASPEAGGGGGALKASSAPAAAAGLLREAGSGDRERADWRRR
QLRTSTECGAGPAAGAAALPPRPGRGGDLGGGQRAMNECRAPCTASRGSERRDYGPLAGT
RAPEHPPTPPESGGAPDPAWGTGRVRAEEFVIVCRHVTGVRAALREPVAKRCGGPRLALW
DSRNRGSPRSPGGGARPCGGAPGRVSPGPGHWGARPEPAAGGGRKRGGVDGEPEVGWGTE
RAEEKAGGPRGRDRQSPSARSWLESLGRYRGPGPDAGGAPPAPAAGLGADGSVTPVKADR
MCQPFSFKAVVAAPRSPSGLALGPRRGCGASCSVPRRGPPAEFQGPHSTVGFGSDAYEVQ
LGIAFQLGQRVHLTRSQSNFGVWFYSNYPFCLFLEIIFHIYISHFLCFSLHFSREMENKE
TLKGLHKMDDRPEERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHL
AAESPGEAQASAASSASKGRRSPSPGNSPSGRPVKSESPGVRRKRVSPVPFQSGRITPPR
RAPSPDGFSPYSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCS
CGRGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTI
QKFVSRMSNSHTLSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLH
HHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTIQQQPL
AGSQRRNQESNFNLTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRL
SHDVSGALLLANGESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCNVLSMVCADPV
YKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLL
ELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLE
FPAEFYPHIVSTDVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMV
TAVPHVFSKLLEMLSVSSSTHFTRMRRRLMAIADEVEIAEAIELGVEDNLDSQQDGFLQA
SVPSNYPETTENSSPECTIHLDKTGKGLCATKLSASSENISDRLASISLGPPSSTTTEQP
KPMVQTKGRPHSQCLNSSPLSHHSQLMFPALSTPSSSAPSVPAGTATDVSKHRLQGFVPC
KIPSASPQTQRKFSLQFQRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSK
QGDPSKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSI
EDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIA
MAMSASQDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLG
AFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGA
TCEKSNYNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKG
ANLLIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDV
WSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQ
PQDRPPSRELLKHPVFRTTW
NT seq 5283 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccggggctgca
agccctgaggcgggcggcggcggaggggccctcaaggcgagcagcgcgcccgcggcggcc
gcgggactgctgcgggaggcgggcagcggggaccgcgagcgggcggactggaggcggcgg
cagctgcgcacaagtacggagtgtggagctggaccagctgccggagccgccgctcttcct
ccgcggccggggcgcggcggggacttggggggcgggcagagggcaatgaatgaatgccgg
gctccgtgcacggcgtcccggggctcagagcggcgagactacgggccgctcgccgggacc
cgcgcccctgagcaccccccgacccctccggagtcgggcggcgccccggacccagcctgg
gggaccggacgggtacgtgcagaagagtttgttattgtttgtagacatgtgacaggcgtg
cgagccgcgctgcgggaacccgtggcgaaaaggtgtggggggccacggctagctttgtgg
gactcccggaatcggggctctccgaggagcccggggggcggggcacggccctgcggcggc
gcccccggacgggtgtccccggggccggggcactggggggcgaggcccgagcctgcggcg
ggcggtggtcggaaaaggggcggggtggatggggagcccgaggtcgggtgggggacggag
agggccgaagagaaagcaggaggtccccgcggccgtgacaggcagagcccctcggcccgc
tcgtggctcgagtcgctaggcaggtaccgggggccgggcccggacgcgggcggcgcgccc
ccagcgcctgctgcagggctcggggcagacggctccgtaacgcctgtcaaagcggaccgg
atgtgtcagccattcagtttcaaagcagtagtggctgctccccgcagcccctccggcttg
gccctgggaccgcggcgcgggtgcggtgcttcctgctcggtgccgcggcgcgggccgcca
gctgaattccaggggccacacagcacggtgggcttcggctcagatgcatatgaagtacag
ctaggcatcgcatttcagcttggtcagcgtgtgcacctgactagaagccagtcaaatttt
ggtgtttggttttattcgaactatccgttctgtttgttcttggaaattatttttcatata
tacatttctcattttctttgcttctccctccattttagtcgtgagatggagaataaagaa
actctcaaagggttgcacaagatggacgatcgcccagaggaacgaatgatcagggagaaa
ctgaaggcaacctgtatgccagcctggaagcacgaatggttagaaaggagaaataggcga
ggccctgtggtggtaaaaccaatcccagtcaaaggagatggatctgaaatgaatcacttg
gcagctgagtctccaggagaggcccaggcgagtgcagcttcatcagcttccaaaggccga
cgcagtccttctcctggcaactccccatcaggtcgcccggtgaaatcagaatctccggga
gtaaggcgaaaaagagtttccccagtgccttttcagagtggcagaatcacaccaccccga
agagccccttcaccagatggcttctcaccatacagccctgaggaaacaaatcgccgtgtt
aacaaagtgatgcgggccagattgtacttactgcagcagatagggcccaactctttcctg
attggaggagacagcccagacaataaataccgggtgtttattggacctcagaactgcagc
tgtgggcgtggaacattctgtattcatctgctgtttgtgatgctccgggtgtttcagcta
gaaccttcagacccaatgttatggagaaaaactttaaagaattttgaggttgagagtttg
ttccagaaatatcacagtaggcgtagctcaaggatcaaagctccatctcgtaacaccatc
cagaagtttgtttcacgcatgtcaaattctcatacattgtcatcatctagtacttctaca
tctagttcagaaaacagcataaaggatgaagaggaacagatgtgtcctatttgtttattg
ggcatgcttgatgaagaaagtcttacagtgtgtgaagacggctgcaggaacaagctgcac
catcactgcatgtcaatttgggcagaagagtgtagaagaaatagagaacctttaatatgt
cccctttgtagatctaagtggagatctcatgatttctacagccatgagttgtcaagtcct
gtggattccccttcttccctcagagctgcacagcagcaaactatacagcagcagcctttg
gctggatcacagagaaggaatcaagagagcaattttaaccttactcattatggaactcag
caaatccctcctgcttacaaagatttagctgagccatggattcaggtgtttggaatggaa
ctcgttggctgcttattttctagaaactggaatgtgagagagatggccctcaggcgtctt
tcccatgatgtcagtggggccctgctgttggcaaatggggagagcactggaaactctggg
ggcagcagtggaagcagcccgagtgggggagccaccagtgggtcttcccagaccagtatc
tcaggagatgtggtggaggcgtgctgcaacgttctgtcaatggtctgtgccgaccctgtc
tacaaagtgtacgttgctgctttaaaaacgttgagagccatgctggtatatactccttgc
cacagtttagcagaaagaatcaaacttcagagacttctccggccagttgtagacaccatc
ctagtcaaatgtgcagatgccaatagccgcacaagtcagctgtccatatcaacattgttg
gagttgtgcaaaggccaagcaggagagttggcagttggtagagaaatactaaaagctgga
tccattggtattggtggtgttgattatgtcttaaattgtattcttggaaaccaaactgaa
tcaaacaactggcaagaactccttggccgcctttgtcttatagacagactgttgttggaa
tttcctgctgaattttatcctcatattgtcagtactgatgtttcacaagctgagcctgtt
gaaatcaggtataagaagctgctgtccctcttaacctttgctttacagtccattgataat
tctcactcaatggttggtaaactttccagaaggatctacttgagttctgcaagaatggtc
actgcagtaccccatgtgttttcaaaactgttagaaatgctgagtgtttccagttccact
cacttcaccaggatgcgtcgccgtttgatggctattgcagatgaggtggaaattgctgaa
gccatcgagttgggcgtagaagacaatttggatagtcaacaggatggctttttgcaggca
tctgtccccagcaactatccagaaaccacagagaacagttcccctgagtgtacaatccat
ttagacaaaactggaaaaggattatgtgctacaaaattgagtgccagttcagagaacatt
tctgacagactggccagcatttcactaggacctcctagttcaacaacaacagagcaacca
aagccaatggttcaaacaaaaggcagaccccacagtcagtgtttgaactcctctccttta
tctcatcattcccaattaatgttcccagccttgtcaaccccttcttcttcagccccatct
gtaccagctggcactgcaacagatgtctctaagcatagacttcagggattcgttccctgc
aaaataccttctgcatctcctcaaacacagcgcaagttttctctacaattccagagaaac
tgtcctgaaaacaaagactcagataaactttccccagtctttactcagtcaagacccttg
ccctccagtaacatacacaggccaaagccatctcgacctaccccaggtaatacaagtaaa
cagggagatccctcaaaaaatagcatgacacttgatctgaacagtagttccaaatgtgat
gacagctttggctgtagcagcaatagtagtaatgctgttatacccagtgatgagacagtg
ttcaccccagtagaggagaaatgcagattagatgtcaatacagagctcaactccagtatt
gaggaccttcttgaagcatctatgccttcaagtgatacaacagtaacttttaagtcagaa
gttgctgtcctgtctcctgaaaaggctgaaaatgatgatacctacaaagatgatgtgaat
cataatcagaagtgcaaagaaaagatggaagctgaagaagaagaagctttagcaattgcc
atggcaatgtcagcgtctcaggatgccctccccatagttcctcagctgcaggttgaaaat
ggagaagatatcatcattattcaacaggatacaccagagactctaccaggacataccaaa
gcaaaacaaccatatagagaagacactgaatggctgaaaggtcagcagataggccttgga
gcattttcttcttgttaccaggctcaagatgtgggaactggaactttaatggctgttaaa
caggtgacgtatgtcaggaacacatcttctgagcaagaagaagtggtagaagcattaaga
gaagagataagaatgatgagccatctgaatcatccaaacattattaggatgttgggagcc
acgtgtgagaagagcaattacaatctcttcatcgaatggatggcagggggatctgtggct
catttgctgagtaaatatggagctttcaaagaatcagtagttattaactatactgaacag
ttacttcgtggcctttcatatctccatgaaaaccaaatcattcacagagatgtcaaaggt
gccaatttactaattgacagcactggtcagagactaagaattgcagattttggagctgca
gccaggttggcatcaaaaggaactggtgcaggagagtttcagggacagttactggggaca
attgcgtttatggcacctgaggtactaagaggtcaacagtatggaaggagctgtgatgta
tggagtgttggctgtgctattatagaaatggcttgtgcaaaaccaccatggaatgcagaa
aaacactccaatcatcttgctttgatatttaagattgctagtgcaactactgctccatcg
atcccatcacatctgtctcccggtttacgagatgtggctcttcgttgtttagaacttcaa
cctcaggacagacctccatcaagagagctactgaagcatccagtctttcgtactacatgg
tag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406711
Entry
100406711         CDS       T03264                                 

Gene name
MAP3K2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04540  Gap junction
cjc04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100406711 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100406711 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100406711 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100406711 (MAP3K2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100406711 (MAP3K2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE11 family
   100406711 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like
Other DBs
NCBI-GeneID: 100406711
NCBI-ProteinID: XP_017828844
Ensembl: ENSCJAG00000010475
LinkDB
Position
6
AA seq 620 aa
MMDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQF
PRPVKLEDLRSKAKIAFGQPMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILL
VINGSTQATNLEPLPSLEDLDNTISVAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVAR
NGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQS
YPDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSFRSPV
SFSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLG
KLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIV
QYYGCLRDPQEKTLSIFMEYMPGGSIKVQLKAYGALTENVTRKYTRHNLEGVHYVHSNMI
VHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYG
RKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFV
EAKLRPSADELLRHMFVHYH
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgatggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataag
gccagtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaa
aagcagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttc
cccagaccagttaaactggaagatctgagatctaaagctaaaattgcctttgggcagcct
atggatctacattataccaacaacgagttggtaattccattaactactcaagatgacttg
gacaaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattactt
gtaataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttg
gacaatacaatatccgtagcagagaggaaaaaacggctttctataataggtcctactagt
agagatagaagttctcctcccccgggatacattccagatgaattacaccaggttgcccgg
aatgggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaa
atgctggatccattatctttaagcagtcctgaaaattctggctcaggaagttgtccatca
cttgatagtcctttggatggagagagctatccaaaatcacgaatgcctagggcacagagc
tacccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttgga
aaaggaggaacgtatccaagaaggtatcatgtttcatatcatcatcaagagtataacgat
ggtcgtaaaacttttccaagagctagaaggacccaggggaccagcttccggtctcctgtg
agtttcagtcctaccgatcactccttaagcactagtagtggaagcagtatctttacccca
gagtatgatgatagtagaataagaaggaggggaagtgacatagacaatcctactctgacc
gtaatggacatcagcccacccagccgttcacctcgtgctccaaccaactggagattgggc
aaactgcttggccaaggagcctttggaagggtctacctctgttatgatgttgatacagga
agagaattggctgttaagcaagttcaatttgatcctgatagtcctgagaccagcaaggaa
gtaaatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgtt
cagtattatggctgtttgagagatccccaggaaaaaacactttccatatttatggaatat
atgccagggggttcaattaaggtccaattaaaagcatatggcgctcttactgagaatgtg
actaggaaatacacccgtcataatctggagggtgtccattatgtgcacagtaatatgatt
gtccatagagacatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaacta
ggagattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaag
tctgtcacgggcacaccatactggatgagccctgaagtaatcagtggagaaggctatgga
agaaaagcagatatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagcct
ccttgggctgaatttgaagcaatggctgccatctttaaaatcgccactcagccaacaaac
ccaaagctgccacctcatgtctcagactatactcgagatttcctcaaacggatttttgta
gaggccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcac
tag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409608
Entry
100409608         CDS       T03264                                 

Gene name
MAP3K3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04912  GnRH signaling pathway
cjc05166  Human T-cell leukemia virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100409608 (MAP3K3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100409608 (MAP3K3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100409608 (MAP3K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100409608 (MAP3K3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100409608 (MAP3K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100409608 (MAP3K3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100409608 (MAP3K3)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE11 family
   100409608 (MAP3K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 100409608
NCBI-ProteinID: XP_008995128
Ensembl: ENSCJAG00000019716
LinkDB
Position
5
AA seq 657 aa
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTT
SSCAGASEKKKFLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNE
LSILLKNQDDLDKAIDILDRSSSMKSLRVLLLSQDRNHSSSSPHSGVSRQVRIKASQSAG
DINTIYQPPEPRSRHLSVSSQNLGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETS
EQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKG
VKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYL
DPRGRLRSADSENSLSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELA
SKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGG
SVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFG
ASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE
YEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLMY
NT seq 1974 nt   +upstreamnt  +downstreamnt
atggacgaacaggaggcattgaactcaatcatgaacgatctggtggccctccagatgaac
cgacgtcaccggatgcctggatatgagaccatgaagaacaaagacacgggtcactcaaat
aggcagaaaaaacacaacagcagcagctcagcccttctgaacagccccacagtaacaaca
agctcatgtgcaggggccagtgagaaaaagaaatttttgagtgacgtcagaatcaagttt
gagcacaacggggagaggcgaattatagcgttcagccggcctgtgaaatacgaagatgtg
gaacacaaggtgacaacagtatttggacaacctcttgatttacattacatgaacaatgag
ctctccatcctgctgaaaaaccaagatgatcttgataaagcaattgacattttggataga
agctcgagcatgaaaagccttagggtattgctgctgtcccaggacagaaaccatagcagt
tcctccccccattctggggtgtccagacaggtgcggatcaaggcttctcagtccgcaggg
gatataaatactatataccagccccctgagcccagaagcaggcacctctccgtcagctcc
cagaaccttggtcgaagctcacctccccctggctatgttcctgagcggcagcagcacatt
gcccggcaggggtcctacaccagcatcaacagtgagggggagttcatcccagagaccagc
gaacagtgcatgctggatcccctgagcagtgcagaaaattccttgtctggaagctgccaa
tccttggacaggtcagcagacagcccatccttccggaaatcacgaatgtcccgtgcccag
agcttccctgacaacagacaggaatactcagatcgggaaactcagctctatgacaaaggg
gtcaaaggtggaacctacccccggcgctaccatgtgtctgtgcaccacaaagactacagc
gatggcagaagaacatttccccgaatacggcgtcatcaaggcaacttgttcaccctggtg
ccctccagccgctccctgagcacaaatggcgagaacatgggtctagctgtgcaatacctg
gacccccgtgggcgcctgcggagtgcagacagcgagaattccctctctgtgcaggagagg
aatgtgccaaccaagtctcccagtgcccccatcaattggcgccgaggaaagctcctgggc
cagggtgcctttggcagggtctatttgtgctatgacgtggacacaggacgtgaacttgct
tccaagcaggtccagtttgacccagacagtcctgagacaagcaaggaggtgagtgctctg
gagtgtgagatccagttgctaaagaacttgcagcatgagcgcatcgtgcagtactatggc
tgtctgcgggaccgtgctgagaagaccctgaccatcttcatggagtacatgccagggggc
tccgtgaaagaccagctgaaggcctatggtgctctgacagaaagtgtgacccgaaagtac
acgcggcagatcctggagggcatgtcctatctgcacagcaacatgatcgttcaccgggac
attaagggagccaacatcctccgagactctgctgggaatgtgaagctgggggactttggg
gccagcaaacgcctgcagacgatctgtatgtcagggacgggcatgcgctccgtcactggc
acaccttactggatgagtcctgaggtgatcagcggtgagggctatggaaggaaagcagac
gtgtggagcctgggctgcactgtggtggagatgctgacagagaaaccaccgtgggcagag
tatgaagctatggccgccatctttaagattgccacccagcccaccaatcctcagctgccc
tcccacatctctgaacatggccgggacttcctgaggcgcatttttgtggaagctcgccag
agaccttcagctgaggagctgctcacacaccactttgcacagctcatgtactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413660
Entry
100413660         CDS       T03264                                 

Gene name
MAP3K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100413660 (MAP3K4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100413660 (MAP3K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100413660 (MAP3K4)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100413660 (MAP3K4)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE11 family
   100413660 (MAP3K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 100413660
NCBI-ProteinID: XP_002747212
Ensembl: ENSCJAG00000012176
LinkDB
Position
4
AA seq 1552 aa
MREAAAALVPPPAFTVTPAAAMEEPPPPEPQPESEPERECCLAARQECTLGDSACKSPES
DPEDFSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNTPNQPPHK
DTGKAVENVEEYSYKQEKKIRATLRTTERDHKKNVQCSFMLDSVGGSLPKKSIPDVDLNK
PYLSLGCSNAKIPVSVPMPIARPARQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQ
RGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDLFLYTARQAIPDIINEILTFKVDYG
SFALVRDGASFNGTSVEGQCRATPGAKIVGYSTHHEHLQRQRVSFEQVKRIMELLEYIEA
LYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLSDIGWPV
FEIPSPRPSKGNEPEYEGEDTEGELKELESSTDESEEEQISDPRVLEIRQPVDNSFDIQS
QDCVSKKLERLESEDDSIGWGAPDCSAEAGFSRHCLTSIYRPFVDKALKQMGLRKLILRL
HKLMDGSLQRARIALVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEQKHSAVSWEELKA
MDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMK
QYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLL
EEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEVGLEESCAEFWTSADDSSA
SDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLCVLK
SKQYVKVQIPGLENLQVFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDTYLLLTKH
SDGARDSEDGWGTWKAQPVKVVPQVETVDTLRNMQVDNLLLVVTQSAHLTIQRKAFQQSI
EGLITLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESV
TLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTKCESGRG
TRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLAIHR
NSPRPVKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASVAAELQFRSLSRHSSPTEE
RDEPAYPRGDSSGFTRRSWELRTLISQSKDTASKLGPIETIQKSVRLFEEKRYREMRRKN
IIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRF
QPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQ
EHVIRLYSKQITIAINVLHDHGIVHRDIIGANIFLTSSGLIKLGDFGCSVKLKNNAQTMP
GEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMY
KVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE
NT seq 4659 nt   +upstreamnt  +downstreamnt
atgagagaagccgcagccgcgctggtccctcctcccgcctttaccgtcacgcctgccgcc
gccatggaggagccgccaccgccggaaccgcagcccgagtccgaacccgaacgcgagtgt
tgcttggcggcgaggcaagagtgtacattgggagattcagcttgcaagagtcccgagtct
gatccagaggacttctctgatgaaacaaatacagagaatctttatggcacctctcccccc
agcacacctcgacagatgaaacgcatgtcaaccaaacaccagaggaataatgtggggagg
ccagctagtcggtctaatttgaaagaaaaaatgaatacaccaaatcagcctccacataaa
gacactggaaaagcagtggagaatgtggaagaatacagctataagcaggagaaaaagatc
cgagcaactcttagaacaacagagcgtgatcataaaaaaaacgtacagtgctcattcatg
ttagactcagtgggtggatctttgccaaaaaagtcaattccagatgtggatctcaataag
ccttacctcagccttggctgtagcaatgctaagattccagtatctgttcccatgcctata
gccagacctgcacgccagacttctaggactgactgtccagcagatcgcttaaagtttttt
gaaacattacgacttttgctaaagcttacctcagtgtcaaagaagaaggacagggagcaa
agaggacaagaaaatacatctggtttctggcttaatcgatctaacgaacttatctggtta
gagctacaggcctggcatgcaggacggacaattaacgaccaggacttgtttttatataca
gcccgtcaagccatcccagatattatcaatgaaatccttactttcaaagtcgactatggg
agcttcgccttggttagagatggagctagttttaatggtacttcagtagaagggcagtgc
agagccactcctggagcaaagattgtgggttactcaacacatcatgagcatctccaacgc
cagagggtctcgtttgagcaggtaaaacggataatggagctgctagaatacatagaagca
ctttatccatcattgcaggctcttcagaaggactatgaaaaatatgctgcaaaagacttc
caggacagagtgcaggcactctgtttgtggttaaacatcacaaaagacttaaatcagaaa
ttaaggattatgggcactgttttgggcatcaagaatttatcagacattggctggccagtg
tttgaaatcccttcccctcgaccatccaaaggtaatgagccagagtatgagggtgaagac
acagaaggagaattaaaggagttggaaagtagtacggatgagagtgaagaagaacaaatc
tctgatcctagggtactggaaatcaggcagcccgtagacaacagcttcgacatccagtcg
caggactgcgtatccaagaagcttgagaggctcgaatctgaggatgattctattggctgg
ggagcaccagactgcagcgcagaagcaggctttagtagacattgtctgacttctatttat
agaccatttgtagacaaagcactgaagcagatggggttaagaaagttaattttaagactt
cacaagctaatggacggttccttgcaaagggcacgtatagcattggtaaagaacgatcgt
ccagtggagttttctgaatttccagatcccatgtggggttcagattatgtgcagttgtca
agaacgccaccttcatctgagcagaaacacagtgctgtgtcatgggaagagctgaaggcc
atggatttaccttcattcgaacctgccttcctggttctttgccgagtccttctgaatgtc
atacatgagtgtctgaaattaagattggagcagagacctgctggagaaccatctctcttg
agtattaagcagctggtgagagagtgtaaggaggtcctgaagggcggcctgctgatgaag
cagtactaccagttcatgctgcaggaggttctggaggacttggagaagcccgactgcaac
attgacgcgtttgaagaggatctgcataaaatgcttatggtgtattttgattacatgaga
agctggatccaaatgctacagcaattacctcaagcatcccatagtttaaaaaacctgtta
gaagaagaatggaatttcaccaaagaaataactcattacatacggggaggagaagcacag
gccgggaagcttttctgtgacattgcaggaatgctgctgaaatctacaggaagtttttta
gaagttggcttagaggagagctgtgctgaattttggaccagtgccgatgacagcagtgct
tccgacgaaatcaggaggtctgttatagagatcagccgggcactgaaggagctcttccat
gaggccagagaaagggcctccaaagcacttggatttgctaaaatgttgagaaaggacctg
gaaatagcagcagaattcaggctttcagctccagttagagacctcctgtgtgttctgaaa
tcaaaacagtatgttaaggtacaaattcctgggttagaaaacttacaggtgtttgttcca
gacacacttgctgaggagaagagtattattctgcagttactcaatgcagctgcaggaaaa
gactgttcaaaagattcagatgatgtactcatcgacacctacctgcttctgaccaagcac
agtgatggagcccgtgattcagaggacggctggggcacatggaaggcacagcctgtcaaa
gtcgtgcctcaggtggagactgttgacaccctgagaaacatgcaggtggataatctttta
ctagttgtcacacagtctgcccatctcacaattcagagaaaagctttccagcagtccatt
gagggacttataactctgtgccaggagcagacatccagtcagccggtcatcgccaaagct
ttgcagcagctaaagaatgatgcattagagctatgcaacagaataagcaatgccattgac
cgcgtggaccacatgttcacatcagaatttgatgctgaagttgatgaatctgaatctgtc
accttgcaacagtactaccgagaagcaatgattcaggggtacaattttggatttgagtat
cataaagaagttgttcgtttgatgtctggggagtttagacagaagataggagacaaatac
ataagctttgctcggaagtggatgaattacgtcctgactaaatgtgagagcggtagaggt
acaagacccaggtgggcaactcaaggttttgattttctacaagcaattgaacctgccttt
atttcagctttaccagaagatgacttcttgagtttacaagccttgatgaatgaatgcatc
ggccatgtcataggaaaaccacacagtcctgttacaggtttgtaccttgccattcatcgg
aacagcccccgccctgtgaaggtacctcgatgccacagtgaccctcctaacccacacctc
attatccccactccagagggattcaggggttccagtgtccctgaaaatgatcgattggct
tccgtagctgctgaattgcagtttaggtccctgagtcgccactcaagccccacggaggaa
cgagacgaaccagcatatccaagaggggattcaagtgggttcacaagaagaagttgggaa
cttcggacactaatcagccagagtaaagatactgcttctaaactaggacccatagaaact
atccagaagtcagttcgattgtttgaagaaaagaggtaccgagaaatgaggagaaagaat
atcattggtcaagtttgtgatacgcctaagtcctatgataatgttatgcatgttggcttg
aggaaggtgaccttcaagtggcaaaggggaaacaaaattggagaaggccagtacgggaag
gtctacacctgcatcagcgttgacaccggggagctgatggccatgaaggagattcgattt
caacctaatgaccataagactatcaaggaaactgcagacgaactgaaaatattcgaaggc
atcaaacaccccaatctggttcggtattttggtgtggagctgcatagagaagaaatgtac
atcttcatggagtactgtgacgagggaacgttagaggaggtgtcaaggctgggacttcag
gagcatgtgattaggctgtattcaaagcagatcaccattgcaatcaatgtcctccatgat
catggcatagtccaccgtgacattataggtgccaatatcttccttacctcatctggatta
atcaaactgggagattttggatgctcggtaaagctcaagaacaatgcccagaccatgcct
ggtgaagtgaacagcaccctggggacagcagcatacatggcacctgaagtcatcactcgc
gccaaaggagaaggccatgggcgtgcagccgacatctggagtctggggtgtgttgtcata
gaaatggtgactggcaagaggccttggcatgagtatgagcacaactttcaaattatgtat
aaagtggggatgggacataagccaccaatccctgaaagattaagccctgaaggaaaggac
ttcctttctcactgccttgaaagtgacccaaagatgagatggaccgccagccagctcctc
gaccattcgtttgtcaaggtttgcacagatgaagaatga

DBGET integrated database retrieval system