KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389627Help
Entry
100389627         CDS       T03264                                 

Gene name
PPP1R18, phostensin
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 18
  KO
K17559  phostensin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100389627 (PPP1R18)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100389627 (PPP1R18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phostensin Phostensin_N
Motif
Other DBs
NCBI-GeneID: 100389627
NCBI-ProteinID: XP_008992363
Ensembl: ENSCJAG00000019906
UniProt: F6ZK17
LinkDB All DBs
Position
4
AA seq 611 aa AA seqDB search
MTTIPDWKLQLLARRRQEEASVRGREKAERERLSQMPAWKRGLLERRRAKLGLSPGEPSP
VPGTAEAGPADTDESAVLQEAIGPVHQNRFIRQERQQQQQRSEELLAERKPGSLEARERR
PSPGEMRDQSPKRRESREERLSPRETRERRLGIGGAQESSLRPLEARDWRQSPGEAGDKS
SRLSEARKWRLSPVETPERSLRLAESREQSPRRKEVESRLSPGESAYPKLGLTEAHKWRP
DSRESQEQSLVQPEATEWRLRSGEERKGYSEECRRKEGRPVPGVAPEETTELSETLTKEA
QGSSSAGVEAAEQRPMGDSERGMKPTEGWKWTLNSGNAREWTPNDNEAQTQKPEPPESVE
KRLEPPGVEAGEGEAEKEEAGAQGRPLRALQNCCSVPSPLPPEDAGTGGLRQQEEEAVEL
QPPPPAPLSPPPPAPAAPQPPGDPLMSRLFYGVKAGPGVGAPRRSGHTFTVNPRRSVLPT
TPPATPASPATADAAALGAGKKRYPTAEEILVLGGYLRLSRSCLAKGSPERHHKQLKISF
SETALETTYQYPSESSVLEELGPEPEVPSSPNPPATQPDDEEDEEELLLLQPELQGGLRT
KALIVDESCRR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcccagactggaagctacagctgttagcccggcgccggcaggaggaggcg
tccgttagaggccgggagaaggcagaacgggagcgcctatcccagatgccagcctggaag
cgagggcttctggagcgccgccgggccaagcttgggctgtcccctggggagcctagccct
gtgccagggactgcagaagccggacctgcagacacagatgaatctgcggtccttcaggag
gccatcgggccagtgcaccagaaccgattcatccggcaggagcggcagcagcagcagcaa
cggagtgaagagctgctagctgagagaaagcctggatctctggaggcccgggagcggaga
cccagccctggggagatgcgggatcagagccccaagagaagagagtcaagagaagagaga
ctaagtcccagggagaccagagagaggaggctggggatagggggagcccaagagtcgagc
ctgaggcctctggaggctcgggactggaggcaaagcccaggagaggcgggagacaagagc
tcccgactgtcagaggcacggaaatggaggctgagtcctgtagaaactccagagcggagt
ctgagactagcagagtctcgagagcaaagccccagaagaaaagaggtggaaagtagactg
agcccaggggaatctgcctacccgaagttgggcctgacagaggcccataaatggagacct
gactccagagagtctcaggaacagagtttggtacaaccagaggcaacagagtggaggctg
aggtcaggagaagaaagaaaaggctactcagaagaatgtaggagaaaagaagggaggcca
gttccaggggtggccccagaagagactacagagctgtcagagaccctgacaaaggaggcc
caaggcagcagttctgcaggagtggaggctgcagaacagaggcctatgggagacagtgag
aggggcatgaagccaacagaagggtggaaatggaccctgaactctgggaacgctcgagaa
tggacacccaacgacaacgaggctcaaactcagaaaccagaacctccagagtcagtggaa
aagcgtctggagcctcccggtgtggaagctggagaaggggaggctgagaaggaggaggcg
ggagctcagggcaggcctctgagagccctgcagaactgctgctctgtgccctcccccctc
ccaccagaggacgctgggactggaggcctgagacagcaggaagaagaagcagtggaactc
cagcccccaccaccagcccctctatctcccccacccccagccccagctgccccccaacct
cctggggatcccctcatgagccgcctgttctatggggtgaaagcagggccaggggtgggg
gccccccgccgcagtggacacaccttcaccgtcaacccccggcggtctgtgctccctacg
actcccccagccaccccagcctctccagccacagctgatgctgcagccctgggggctggg
aagaagcggtacccaactgccgaggagatcttggttctggggggctacctccgtctcagc
cgcagctgccttgccaaggggtcccccgaaagacaccacaaacagcttaagatctccttc
agcgagacagccctggagaccacgtaccaatacccctccgagagttcggtactggaggag
ttgggcccggagcctgaggtccccagttcccccaaccccccagcaacccaacccgacgat
gaagaggatgaggaagagctgctgctactgcagccagagctccagggcgggcttcgcacc
aaggccctgattgtggatgagtcctgccggcggtga

DBGET integrated database retrieval system