KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389794
Entry
100389794         CDS       T03264                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adaptor molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04144  Endocytosis
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100389794 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100389794 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100389794 (STAM2)
Membrane trafficking [BR:cjc04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100389794 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM ENTH GAT
Other DBs
NCBI-GeneID: 100389794
NCBI-ProteinID: XP_002749486
Ensembl: ENSCJAG00000003346
UniProt: U3ET33
LinkDB
Position
6
AA seq 525 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQIVSAAAKNGTSLNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIQLNNKVVRKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIESEAAAVDKLHIIDDDVEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDVCQQMGPMIDEKLEEIDRKHSELSELNIKVLEALEL
YNKLVNEAPVYSVYSKLHPPAHYPPVSSVVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL
GPDQIGPLRSLPPNVNSSVTTHSAQTSYLSTGQDTVSNPTYMNQKSNLQSATGTTAYTQQ
MGMSVDMSSYQNTTSNLPQLTGFPVTVPAHPVAQQHTNYHQQPLL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcctttgttcaccgccaaccccttcgagcaagacgtggaaaaggccacaaatgagtac
aacactacagaagattggagtcttattatggatatatgtgacaaagttggaagtacacct
aatggagcgaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcat
gttgctctgcaggcactaactcttcttggggcatgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgattaaaaataag
gcacatcctaaagtatgtgaaaaactgaagtctttaatggtggagtggtcagaagaattt
cagaaggaccctcagtttagtctgatatctgcaactattaaatctatgaaagaggaagga
attacttttcctccagcaggttctcagattgtctcagctgctgccaagaatggtacatca
ttgaacaaaaacaaagaggatgaagacatagctaaagctattgaattatcactgcaagag
cagaaacagcaacacacagaaacaaaatccttatatccatctgcagaaattcagttaaat
aataaggttgtacggaaagtgagagctttatatgattttgaagctgttgaggacaatgaa
ctcacctttaaacatggtgaaataattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggactcttcccatccaattttgtaacaactaattta
aacatagagtctgaggcagcggctgtggacaaattgcatataattgatgatgatgtggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtacttcagagtatagatccaacagattcaaaaccagactcccaagaccttttg
gatttagaagatgtctgccagcagatgggcccaatgatagatgaaaaacttgaagagatt
gataggaagcattcagaattgtctgaattgaatataaaagtcttggaagctctggaacta
tataacaaattggtgaatgaagcaccagtatactcagtctattcaaagctccaccctcca
gcacattacccacctgtatcatctgtggttccaatgcagacatatcctgttcaatcacat
ggtggaaactatatgggtcagagcattcaccaagtaacggttgcccaaagctatagccta
ggaccggatcaaattggtccactgagatctctgcctccaaatgtgaattcttcagtgaca
acgcattctgctcaaacttcatatttaagcactggacaagacactgtttccaatcctact
tatatgaaccagaaatctaacctacaatcagctactggtacaactgcttacacacagcaa
atggggatgtctgtggatatgtcatcttatcagaacactacttccaatttgcctcaactg
acaggctttccggtgacagttccagctcatccagttgcacagcagcacacaaattaccat
cagcagcctctcctttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409144
Entry
100409144         CDS       T03264                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adaptor molecule
  KO
K04705  signal transducing adaptor molecule
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04144  Endocytosis
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100409144 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100409144 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100409144 (STAM)
Membrane trafficking [BR:cjc04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100409144 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 100409144
NCBI-ProteinID: XP_002750118
Ensembl: ENSCJAG00000008590
UniProt: F7E7C6
LinkDB
Position
7
AA seq 539 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVGPPSANPALPSQPTQAAYPNTMVSSVQGSTYPSQAPVY
SPPPAATAAAATADVTLYQNAGPNVSQVPNYNLSSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgatcaggatgttgagaaagcaaccagtgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgaggagagtgaaccacaaagatcctcac
gttgctatgcaagctttgactcttctaggagcatgtgtgtccaactgcggcaaaattttt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgacccacagcttagtctaatatcagcaatgattaagaaccttaaggaacaaggagtt
acattcccagctattggctctcaggctgcagagcaagcaaaagcaagcccagctcttgta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gagttgtccctcaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccaacctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagataatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcct
tctaattttgtgactgcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagaaacaatagaaccagagccggaaccagcc
tttattgatgaggataaaatggaccagttgctacaaatgttgcaaagtacagatcccagt
gatgatcagccagacctaccagagctacttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatatcgatagaaaacattcagaactctcagaactt
aatgtgaaagtgatggaggcactttccctatataccaagttaatgaacgaagatcccatg
tattccatgtatgcaaagttacagaatcagccatattatatgcagtcatctggtgtttct
ggttctcaggtatatgcagggcctcctccaagtggtgcctacctggtcgcggggaacgcg
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctcagccag
gcagtgggcccgccatccgcaaacccagcccttcctagtcagccaactcaggctgcttac
ccaaatacaatggtgagttctgttcaaggaagcacgtatcccagtcaggctccagtctat
agtcctcctcctgccgctactgctgctgctgcaaccgccgatgtcactctgtaccagaat
gcaggacctaatgtgtcccaggtgccaaactataacttatcatccaccctgcctcagcct
ggaggcagccaacagccacctcagccacagcaaccatattctcagaaggctctgctatag

DBGET integrated database retrieval system